KEGG   Synechocystis sp. PCC 6803 PCC-N: SYNPCCN_1979Help
Entry
SYNPCCN_1979      CDS       T01778                                 

Gene name
slr0152
Definition
(GenBank) serine/threonine protein kinase
Organism
sys  Synechocystis sp. PCC 6803 PCC-N
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pkinase Pkinase_Tyr APH Pox_ser-thr_kin Kdo
Motif
Other DBs
NCBI-ProteinID: BAL32896
LinkDB All DBs
Position
2179878..2181773
Genome map
AA seq 631 aa AA seqDB search
MESLPVLGVFFMVKTANVAVMPLFPRSQYRIIGQIGQGQFGRVYCAIHRTTGKMYALKDL
EHRVFPTNKFLRELSYLLTLRHPNIVACHGLEYHPGGRYLVMDYCEGGTLRDIIDGDGDL
CLAGKIDLLRQILLGLAQAHQHDIVHCDLKPENILLIPRAEGWQVKVSDFGIARLTAKTG
NPNFSKGYTGSPAYMAPERFYGKFSVASDIYAVGILLYELIVGDRPFSGFPKALQAAHLN
VRLTLPPEFPPLLAPIVQRALEKLPQRRFPNATAMASDLATVQKQILEQDPPRGNGYLYH
HLAPAPLAFTATVKHSTPLLFPISHLTGAGLWLYLGNGAELYLWEYGDGNVEHHPLPRWA
LGLPGTIANLEVNQDQISLLIQGGEPGEWQFYQWRETLLGALSLPKPRINLRAERLLANL
SPGGKTLAVVVGDRDSEKGHFQLWRTDHSLPVAAAVVIRWPDQLLTLDQNHGLLVQSQST
ASYCHTIFFLFNRRGSLFPAFRLSFLVFQLVVNRYSRNHLFGLADNAPYTGILIRLQPLK
VNRIALTIQPQFIEPFPWGYLLADRHGEVALLDYEGFLFGNFSLGETITAIAPMGRYLCL
FATWQGNGGTLRLLDLGPQVENIIRQRQEKR
NT seq 1896 nt NT seq  +upstreamnt  +downstreamnt
atggaatcactccccgtcctaggcgtattttttatggtaaagactgccaatgtggcggtt
atgccgctgtttccccgctcccaatatagaatcattggacagatcggacagggacagttc
gggcgggtttactgtgctattcaccggactacgggcaaaatgtatgccctgaaggattta
gaacatcgggtatttcccactaataaatttctgcgggaactgtcctatctgttgaccctg
cgccatcccaacattgtggcttgccatggtttggagtaccatcctgggggccgctatttg
gtgatggattactgtgaggggggaactctgcgggacattattgatggggacggagattta
tgtttggcgggaaaaatagatttattaagacaaatattgctgggtttggcccaagcccat
cagcatgacattgtccactgtgaccttaaaccggaaaatatcctgttaataccccgggca
gagggatggcaggtaaaagtatcagattttggcattgctcgcctaacagctaaaacgggc
aatcctaatttcagcaagggttacactggttctcccgcctatatggccccggaacggttc
tacggcaagttttctgtagcttccgacatttatgctgtgggtattttgctgtacgagctc
atcgtcggcgatcgcccgttttcaggatttcctaaagcgttgcaggcagcccatctcaat
gtccgcttaaccttaccgccggaatttcctcccttacttgcccccattgtccaacgggct
ttggagaaattaccccaaagacgatttcccaatgccacagccatggccagtgatttggcc
acggttcaaaaacaaatattggaacaggatccccccaggggtaacggctatctttaccat
cacttggctccagctccgctagcctttacggccacagtcaaacacagtactcccttgtta
tttcccattagtcacctaactggggcaggactttggttatacctaggcaatggggccgaa
ctgtacctatgggagtatggcgatggaaatgtggagcaccatcctttgccccgctgggcg
ttgggtttaccgggaaccatagctaatctggaagtaaatcaagaccaaattagcctctta
atccagggaggtgaaccaggagaatggcaattttaccagtggcgagaaaccctacttggc
gctctctctctccccaaacctcgcattaatttgcgggcagagcgtctgttggccaatcta
agccccggtggtaaaactttggcagtggtagtaggcgatcgggacagtgaaaaaggccat
tttcaattatggcgcactgaccacagcttacctgtggctgcagccgtagtaattcgatgg
ccggatcaactgctcaccctagaccaaaaccatggcctgttggtgcagtctcaatcaacg
gcaagttattgtcatactatttttttcctgtttaatcggcgggggtccctgtttccagcc
tttcgcctttcttttttggtatttcaattggtagttaatcgctactcccgcaaccatctg
tttggcttggccgataatgctccctacactggtattttgattcgtctgcaacccctgaaa
gtcaatcgcattgccctaactatccagccccaattcattgagccttttccctggggttat
ctactagccgatcgccatggggaagtagctttgttggactatgaaggttttttatttggc
aatttttccctcggggaaaccatcacggcgatcgcccccatgggtcgctatctctgttta
tttgctacctggcagggcaatgggggaactttacgtcttctggatttgggtccccaagtg
gaaaacattattcgccaacgccaggaaaaacgctaa

DBGET integrated database retrieval system