KEGG   Synechocystis sp. PCC 6803 PCC-N: SYNPCCN_2600Help
Entry
SYNPCCN_2600      CDS       T01778                                 

Gene name
slr0091
Definition
(GenBank) aldehyde dehydrogenase
  KO
K00128  aldehyde dehydrogenase (NAD+) [EC:1.2.1.3]
Organism
sys  Synechocystis sp. PCC 6803 PCC-N
Pathway
sys00010  Glycolysis / Gluconeogenesis
sys00053  Ascorbate and aldarate metabolism
sys00071  Fatty acid degradation
sys00280  Valine, leucine and isoleucine degradation
sys00310  Lysine degradation
sys00330  Arginine and proline metabolism
sys00340  Histidine metabolism
sys00380  Tryptophan metabolism
sys00410  beta-Alanine metabolism
sys00561  Glycerolipid metabolism
sys00620  Pyruvate metabolism
sys00625  Chloroalkane and chloroalkene degradation
sys01100  Metabolic pathways
sys01110  Biosynthesis of secondary metabolites
sys01120  Microbial metabolism in diverse environments
sys01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:sys00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SYNPCCN_2600 (slr0091)
   00053 Ascorbate and aldarate metabolism
    SYNPCCN_2600 (slr0091)
   00620 Pyruvate metabolism
    SYNPCCN_2600 (slr0091)
  Lipid metabolism
   00071 Fatty acid degradation
    SYNPCCN_2600 (slr0091)
   00561 Glycerolipid metabolism
    SYNPCCN_2600 (slr0091)
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    SYNPCCN_2600 (slr0091)
   00310 Lysine degradation
    SYNPCCN_2600 (slr0091)
   00330 Arginine and proline metabolism
    SYNPCCN_2600 (slr0091)
   00340 Histidine metabolism
    SYNPCCN_2600 (slr0091)
   00380 Tryptophan metabolism
    SYNPCCN_2600 (slr0091)
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    SYNPCCN_2600 (slr0091)
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    SYNPCCN_2600 (slr0091)
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    SYNPCCN_2600 (slr0091)
Enzymes [BR:sys01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.3  aldehyde dehydrogenase (NAD+)
     SYNPCCN_2600 (slr0091)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh UvsY
Motif
Other DBs
NCBI-ProteinID: BAL33517
LinkDB All DBs
Position
2896527..2897897
Genome map
AA seq 456 aa AA seqDB search
MNTAKTVVAEQRDFFRQGKTKSVQDRLTALAKLKTQIQAQEEEIIKALKQDFGKPTFESY
VNEILGVIREINYYQKHLQQWSKPQRVGTNLMVFPASAQLRPEPLGVVLIISPWNYPFYL
CLMPLIGAIAAGNCVVVKPSEYTPAISGVITRLIQNVFSPAWATVVEGDETISQQLLQEK
FDHIFFTGSPRVGRLIMAAAAEQLTPVTLELGGKSPCVVDREINLQETAKRIMWGKLVNA
GQTCVAPDYLLVEQSCLEQLLPALQQAIQMLFGENPAHSPDYTRIVNQQQWSRLVSLLSH
GKVITRGDHNEGDRYIAPTLIIDPDLNSPLMQEEIFGPILPILTYQSLSEAIDFINIKPK
PLALYFFSNNRQKQEEILQSTSSGSVCLNDILLHLTVTDLPFGGVGESGMGRYHGKATFD
TLSNYKSILRRPFWGETNLRYSPYGKKMNLIKKLFS
NT seq 1371 nt NT seq  +upstreamnt  +downstreamnt
atgaatactgctaaaactgttgttgctgagcaaagggacttttttcgtcagggcaaaact
aaatcagtccaagatagattaacagctctagcaaaattaaaaacgcaaattcaagcccag
gaagaggaaattattaaggcccttaagcaagattttggtaagcccacctttgaaagctat
gtaaacgaaattttgggggtaattagggaaattaattattatcaaaaacatcttcagcaa
tggtctaagccccaacgggtaggtacgaatctgatggtttttcctgccagtgcccagtta
agaccagaaccccttggtgtagtgctaattattagcccctggaattatcctttttatctt
tgtttaatgcccttgatcggggcgatcgccgctggaaattgtgtggtggtaaagccgtcg
gaatatactccagctattagtggggtaattaccagattaatccaaaatgtattttccccg
gcttgggcaacagtggtggagggagatgaaaccattagccaacaattgttacaggaaaaa
tttgaccatattttctttaccggcagccctagggtgggtcggttaattatggcagctgcg
gcagagcaattaaccccagttacgttggaattggggggtaaatctccctgtgtggtggat
agggaaatcaacctccaggaaacagccaaacgcattatgtggggcaagctagtcaatgct
ggccaaacctgtgtggcaccggattatttattggtggagcaatcctgcttagaacaactt
ttaccagctttacaacaggcaattcagatgcttttcggggaaaatccagcccatagccct
gactacactcgcattgttaaccaacaacaatggtcacggttagttagtttattaagccat
ggcaaagtaattacaaggggagatcataacgaaggcgatcgctacattgccccaacttta
atcatcgatccagatttaaattctcccttaatgcaagaggaaatatttggcccaattttg
ccaattttaacttatcagagtttgtcagaagcaatagattttattaacatcaaacctaaa
ccattggcactttatttttttagcaataatcggcaaaaacaggaggaaattttgcaatct
accagttccggtagtgtttgtttgaacgatattttgcttcatttaactgtgacagactta
ccctttggtggggtgggagaaagtggtatgggacgctaccatggcaaggctacttttgac
acattgagcaattataaaagcattttacgacgacccttttggggggaaactaatttacgc
tattctccctatggcaaaaaaatgaatttaatcaaaaagttgttctcctag

DBGET integrated database retrieval system