KEGG   Synechocystis sp. PCC 6803 GT-I: SYNGTI_1818Help
Entry
SYNGTI_1818       CDS       T01777                                 

Gene name
ppc
Definition
(GenBank) phosphoenolpyruvate carboxylase
  KO
K01595  phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
syt  Synechocystis sp. PCC 6803 GT-I
Pathway
syt00620  Pyruvate metabolism
syt00680  Methane metabolism
syt00710  Carbon fixation in photosynthetic organisms
syt01100  Metabolic pathways
syt01120  Microbial metabolism in diverse environments
syt01200  Carbon metabolism
Module
syt_M00168  CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:syt00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    SYNGTI_1818 (ppc)
  09102 Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    SYNGTI_1818 (ppc)
   00680 Methane metabolism
    SYNGTI_1818 (ppc)
Enzymes [BR:syt01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     SYNGTI_1818 (ppc)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPcase
Motif
Other DBs
NCBI-ProteinID: BAL29565
LinkDB All DBs
Position
complement(1993066..1996170)
Genome map
AA seq 1034 aa AA seqDB search
MNLAVPAFGLSTNWSGNGNGSNSEEESVLYQRLKMVEELWERVLQSECGQELVDLLTELR
LQGTHEAITSEISEEVIMGITQRIEHLELNDAIRAARAFALYFQLINIVEQHYEQNEQQR
NRWEASQETNFYEQAGNEEEMVPPSRLGASTEPLPVGIDQNELQASVGTFHWLMRELKRL
NVPPQHIQNLLDHLDIRLVITAHPTEIVRHTIRRKQRRVDRILRKLDQLQGSVTGRDWLN
TWDAKTAIAQLTEEIRFWWRTDELHQFKPTVLDEVDYSLHYFDEVLFDAVPELSKRLGQA
IKETFPHLRAPRANFCYFGSWVGGDRDGNPSVTPEVTWQTACYQRGLVLGKYLFSLGELV
AILSPSLHWCKVSQELLDSLERDRIQLPEIYEELSLRYRQEPYRMKLAYVTKRLENTLRR
NNRLANPEERQTMITMPAENHYRTGEELLEELRLIQRNLTETGLTCLELENLITQLEVYG
FNLAQLDFRQESSRHAEAIAEIAEYMGVLTTPYEEMAEEDKLAWLGVELQTRRPLIPQEM
PFSERTRETIETLRTLRHLQMEFGVDICQTYIISMTNDASDVLEVLLLAKEAGLYDPATA
SNSLRIVPLFETVEDLKNAPGIMDSLFSLPFYRATLAGSYHSLKELQNQPPDYYQIPTTT
ALLNPGNLQEIMVGYSDSNKDSGFLSSNWEIHKAQKSLQAVAQSHRVILRLFHGRGGSVG
RGGGPAYKAILAQPAGTVDGRIKITEQGEVLASKYSLPELALYNLETLTTAVIQASLLKS
SFDFIEPWNRIMEELACTARRAYRSLIYEEPDFLDFFLTVTPIPEISELQISSRPARRKG
GKADLSSLRAIPWVFSWTQTRFLLPAWYGVGTALKSFVDQDPVKNMKLLRYFYFKWPFFN
MVISKVEMTLSKVDLTIASHYVQELSKPEDRERFDRLFQQIKQEYQLTRDFAMEITAHPH
LLDGDRSLQRSVLLRNRTIVPLGLLQISLLKRLRQVTQEAETSGVRYRRYSKEELLRGAL
LTINGIAAGMRNTG
NT seq 3105 nt NT seq  +upstreamnt  +downstreamnt
atgaacttggcagttcctgcattcggtctttccactaactggtctggtaatggcaatggt
tccaactctgaagaagagtcggtgctttaccagcggttaaagatggtggaggaattgtgg
gaaagggtgctccaaagcgaatgtggccaggaattggtggatttgctgacggaattaagg
cttcagggtacccatgaggcgatcaccagcgaaatttccgaagaagtcatcatgggtatt
acccagcgcattgagcatttagaactcaatgatgccatccgggcggctcgggcctttgcc
ctatatttccagttgatcaacatcgttgaacagcactacgaacaaaacgagcaacaacgg
aatcgttgggaagcttcccaggaaaccaacttctatgagcaggcgggcaatgaggaagaa
atggtccccccatcccgattaggcgcgtcaacggaaccattgccagtgggcattgaccag
aatgaattgcaagcttctgtaggtacgttccattggttaatgagggagctaaaacgcctc
aatgtgcccccccaacatatccaaaatttattggatcatctggacattcgcctggtgatc
accgctcaccccacggaaattgtccgtcacaccatccggcgcaaacaaagaagggtggac
cgcattcttcgtaaactagatcaactccagggttctgtgaccggtcgggactggctcaac
acctgggatgcaaaaacggcgatcgcccaattaacggaggaaattcgcttttggtggcgt
accgacgaacttcatcagttcaaacccactgtgttggacgaagtggactattccctccat
tattttgatgaagtactgttcgacgctgtaccggaattgtccaaacggttaggacaagct
attaaagaaacctttccccatctgcgggccccccgggctaatttttgttattttggctcc
tgggtcggtggcgatcgggacggcaacccttcggtaaccccagaagtgacctggcagacg
gcctgttaccagcggggtttagtgctggggaaatatttgtttagtttgggggaactggtg
gccattcttagcccttccctccattggtgcaaagtctcccaggaattgttggactctttg
gaacgggaccgcattcaattaccggaaatttacgaagaactttctctccgctatcgccag
gaaccctatcggatgaagctggcctacgttaccaaacggctggaaaacaccctgcggcgt
aataatcgtctagccaacccagaagaacggcaaacgatgatcaccatgccggccgaaaat
cactatcgcactggggaagaattattagaggaattaagactcattcagcgtaatctgacc
gaaactggtttaacctgcctggagttggaaaatttgattacccagttggaagtctatggc
tttaacctagcccagttggattttcgccaggaatcttcccgccacgccgaggcgatcgcc
gaaattgctgagtatatgggggtactcaccactccctacgaagaaatggccgaagaagat
aaattagcctggttaggggtagaactgcaaacccgccgtcctttaattccccaggaaatg
cccttttcggagcggactagggaaaccattgaaaccctccgcaccctgcgccatctacaa
atggaatttggggtggatatttgccaaacctacatcatcagcatgaccaacgatgccagt
gatgtgttggaagtattgctgttagccaaggaagccggattgtatgacccggccaccgcc
tccaattccctccgcattgtgcccctgtttgaaacagtagaagatctcaaaaacgctccg
gggattatggattctcttttcagcttgcctttttaccgggctacattggcgggcagttac
cattccttaaaagagttgcaaaatcagccaccggattattaccaaattcccaccaccaca
gccctactaaatcccggcaatctccaggaaattatggtgggctattccgacagcaataaa
gactccggctttttgagcagtaactgggaaattcataaggcccaaaaatcactgcaggca
gtggcccaaagccatcgggtaattctccggctgttccacggtcgaggaggatctgttggc
cgggggggcggcccggcctataaagccattttggcccagcccgcaggcaccgtggacggt
cggatcaaaattaccgaacaaggggaagtgttagcttctaaatattccctgccagagttg
gccctctacaacctggaaactttaaccacggcggtcatccaagctagtttacttaaaagt
agttttgatttcattgagccctggaaccggattatggaggagttggcctgcactgcccgt
cgagcctaccggagtttgatttacgaagaaccggactttttagatttcttcctgacggtt
acccccattcctgaaattagcgagttacagattagttcccgccctgcccgacgtaagggg
ggtaaagcggatctcagcagtttgcgggccattccctgggtgttcagttggacccaaacc
cgtttcctgctgccggcttggtatggggtgggcacggcgttgaaatcctttgtggaccaa
gacccggtcaaaaatatgaagttgttgcgttacttctatttcaaatggcctttcttcaac
atggtgatctcgaaggtggaaatgaccctttccaaggtggacctcaccatcgcttcccac
tatgtgcaagagctatctaagccagaagaccgggaacgattcgatcgcctttttcagcag
atcaagcaagagtatcaattaaccagggactttgccatggaaattacggcccatccccac
ctcctggacggcgatcgctctttgcaacggtcggtactcctacgaaatcgtactattgtt
cccctggggctactgcagatttccctgctgaaacgtttacgccaagtaacccaggaagcg
gagaccagcggcgtgcgttaccgtcgttattccaaagaagaactactgcggggagctctg
ttaaccattaacggtattgcggccggaatgcgtaatactggttga

DBGET integrated database retrieval system