KEGG   Synechocystis sp. PCC 6803 GT-I: SYNGTI_2224Help
Entry
SYNGTI_2224       CDS       T01777                                 

Gene name
rbcL
Definition
(GenBank) ribulose-1,5-bisphosphate carboxylase/oxygenase large subunit
  KO
K01601  ribulose-bisphosphate carboxylase large chain [EC:4.1.1.39]
Organism
syt  Synechocystis sp. PCC 6803 GT-I
Pathway
syt00630  Glyoxylate and dicarboxylate metabolism
syt00710  Carbon fixation in photosynthetic organisms
syt01100  Metabolic pathways
syt01120  Microbial metabolism in diverse environments
syt01200  Carbon metabolism
Module
syt_M00165  Reductive pentose phosphate cycle (Calvin cycle)
syt_M00166  Reductive pentose phosphate cycle, ribulose-5P => glyceraldehyde-3P
syt_M00611  Oxygenic photosynthesis in plants and cyanobacteria
Brite
KEGG Orthology (KO) [BR:syt00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    SYNGTI_2224 (rbcL)
  09102 Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    SYNGTI_2224 (rbcL)
Enzymes [BR:syt01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.39  ribulose-bisphosphate carboxylase
     SYNGTI_2224 (rbcL)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RuBisCO_large RuBisCO_large_N
Motif
Other DBs
NCBI-ProteinID: BAL29971
LinkDB All DBs
Position
2476131..2477543
Genome map
AA seq 470 aa AA seqDB search
MVQAKAGFKAGVQDYRLTYYTPDYTPKDTDLLACFRMTPQPGVPAEEAAAAVAAESSTGT
WTTVWTDNLTDLDRYKGRCYDLEAVPNEDNQYFAFIAYPLDLFEEGSVTNVLTSLVGNVF
GFKALRALRLEDIRFPVALIKTFQGPPHGITVERDKLNKYGRPLLGCTIKPKLGLSAKNY
GRAVYECLRGGLDFTKDDENINSQPFMRWRDRFLFVQEAIEKAQAETNEMKGHYLNVTAG
TCEEMMKRAEFAKEIGTPIIMHDFFTGGFTANTTLARWCRDNGILLHIHRAMHAVVDRQK
NHGIHFRVLAKCLRLSGGDHLHSGTVVGKLEGERGITMGFVDLMREDYVEEDRSRGIFFT
QDYASMPGTMPVASGGIHVWHMPALVEIFGDDSCLQFGGGTLGHPWGNAPGATANRVALE
ACVQARNEGRNLAREGNDVIREACRWSPELAAACELWKEIKFEFEAMDTL
NT seq 1413 nt NT seq  +upstreamnt  +downstreamnt
atggtacaagccaaagcagggtttaaggcgggcgtacaagattatcgcctgacctactat
acccccgactacacccccaaggataccgacctgctcgcctgcttccgtatgaccccccaa
ccgggtgtacctgctgaagaagccgctgctgcggtggccgctgagtcttccaccggtacc
tggaccaccgtttggactgacaacctaactgacttggaccgctacaaaggtcgttgctat
gacctggaagctgttcccaacgaagataaccaatattttgcttttattgcctatcctcta
gatttatttgaagaaggttccgtcaccaacgttttaacctctttggtcggtaacgtattt
ggttttaaggctctgcgggccctccgtttagaagatattcgttttcccgttgctttaatt
aaaaccttccaaggccctccccacggtattaccgttgagcgggacaaattaaacaaatac
ggtcgtcctctgcttggttgtaccatcaaacccaaacttggtctgtccgccaagaactac
ggtcgggctgtttacgaatgtctccggggtggtttggacttcaccaaagacgacgaaaac
atcaactcccagcccttcatgcgttggcgcgatcgtttcctcttcgttcaagaggcgatc
gaaaaagcccaggctgagaccaacgaaatgaaaggtcactacctgaacgtcaccgctggc
acctgcgaagaaatgatgaaacgggccgagtttgccaaggaaattggcacccccatcatc
atgcatgacttcttcaccggcggtttcactgccaacaccaccctcgctcgttggtgtcgg
gacaacggcattttgctccatattcaccgggcaatgcacgccgtagttgaccgtcagaaa
aaccacgggatccacttccgggttttggccaagtgtctgcgtctgtccggcggtgaccac
ctccactccggtaccgtggttggtaaattggaaggggaacggggtatcaccatgggcttc
gttgacctcatgcgcgaagattacgttgaggaagatcgctcccggggtattttcttcacc
caagactatgcctccatgcctggcaccatgcccgtagcttccggtggtatccacgtatgg
cacatgcccgcgttggtggaaatcttcggtgatgattcctgcttacagtttggtggtggt
actttgggtcacccctggggtaatgctcccggtgcaaccgctaaccgtgttgctttggaa
gcttgtgttcaagctcggaacgaaggtcgtaacctggctcgcgaaggtaatgacgttatc
cgggaagcctgtcgttggtcccctgagttggccgccgcctgcgaactctggaaagagatc
aagtttgagttcgaggccatggataccctctaa

DBGET integrated database retrieval system