KEGG   Synechocystis sp. PCC 6803 GT-I: SYNGTI_2296Help
Entry
SYNGTI_2296       CDS       T01777                                 

Gene name
aspC
Definition
(GenBank) aspartate aminotransferase
  KO
K00812  aspartate aminotransferase [EC:2.6.1.1]
Organism
syt  Synechocystis sp. PCC 6803 GT-I
Pathway
syt00220  Arginine biosynthesis
syt00250  Alanine, aspartate and glutamate metabolism
syt00270  Cysteine and methionine metabolism
syt00330  Arginine and proline metabolism
syt00350  Tyrosine metabolism
syt00360  Phenylalanine metabolism
syt00400  Phenylalanine, tyrosine and tryptophan biosynthesis
syt00401  Novobiocin biosynthesis
syt01100  Metabolic pathways
syt01110  Biosynthesis of secondary metabolites
syt01130  Biosynthesis of antibiotics
syt01210  2-Oxocarboxylic acid metabolism
syt01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:syt00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    SYNGTI_2296 (aspC)
   00270 Cysteine and methionine metabolism
    SYNGTI_2296 (aspC)
   00220 Arginine biosynthesis
    SYNGTI_2296 (aspC)
   00330 Arginine and proline metabolism
    SYNGTI_2296 (aspC)
   00350 Tyrosine metabolism
    SYNGTI_2296 (aspC)
   00360 Phenylalanine metabolism
    SYNGTI_2296 (aspC)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    SYNGTI_2296 (aspC)
  09110 Biosynthesis of other secondary metabolites
   00401 Novobiocin biosynthesis
    SYNGTI_2296 (aspC)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:syt01007]
    SYNGTI_2296 (aspC)
Enzymes [BR:syt01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.1  aspartate transaminase
     SYNGTI_2296 (aspC)
Amino acid related enzymes [BR:syt01007]
 Aminotransferase (transaminase)
  Class I
   SYNGTI_2296 (aspC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_1_2 DegT_DnrJ_EryC1 Cys_Met_Meta_PP Aminotran_5
Motif
Other DBs
NCBI-ProteinID: BAL30043
LinkDB All DBs
Position
complement(2556538..2557707)
Genome map
AA seq 389 aa AA seqDB search
MRLTQRVSQVVPSITLEITAKAKAMRTEGIDVLSFTAGEPDFTTPPHIVEAAKLALDEGK
TRYGPAAGEPALRQAIAKKLREKNNLPYEAANILVTNGGKHSLFNLMLAMIEQGDEVIIP
APYWLSYPEMVRLAEGTPVIVNTTAATDYKITPEQLRQAITSKSKLFVLNSPSNPTGAVY
TPAEIRALAAVILEYEDLYVVSDEIYERILYDGTEHLSIGAVNDEIFQRTIISNGFAKSY
SMTGWRVGYLAGELPLIQACSTIQGHSTSNVCTFAQYGAIAALENPQTCVETMVKAFTER
RQVIVEGINQIAGLSCPNPKGAFYVFVDIAKTGLNSLEFSARLLESHQVAVIPGAAFGAD
DCVRFSYATDMDTIKQGLAELERFVSTLA
NT seq 1170 nt NT seq  +upstreamnt  +downstreamnt
atgcgactaacccagcgagttagccaagttgtgccttccatcacccttgaaattacggca
aaggccaaggcaatgcggactgagggcattgatgtgcttagctttaccgctggggaaccg
gattttaccactcccccccacattgtggaggcggccaaattagccttggatgaagggaag
acccgctatggccccgccgccggagaaccggccctccgtcaggcgatcgccaaaaagtta
cgggaaaagaataatttgccctacgaggcggccaatattttggtgaccaatgggggtaaa
cattccctgtttaacctaatgctagccatgattgagcagggggatgaggtaattattccc
gccccctattggctcagttatccagaaatggtgcgtttagccgaaggaaccccagttatt
gtcaacaccacagcggccacggattacaaaatcaccccagagcaactacggcaggccatt
acctccaaaagtaagctgtttgtgctgaattctccttccaatcccaccggggcagtttac
actcctgccgaaattagggctttggcggcggtgattttggaatatgaggatttatacgta
gtttccgatgagatttatgagcgcattctctacgatggcacagagcacctcagcattggt
gcggtgaacgacgagattttccaacgcaccatcattagtaacggttttgccaaaagttat
tccatgaccggttggcgggtgggttacctggcgggggaattacccttaatccaagcctgt
agcaccatccagggccatagcacctccaacgtttgtacctttgcccagtacggggcgatc
gccgctctggaaaatccccaaacctgtgtggagaccatggtcaaagccttcacagaaaga
cgacaggtgatagtggaaggcatcaatcaaattgcagggctgagttgtcctaatccgaaa
ggagcattttatgtttttgtggacattgctaaaacggggcttaattccctggagttcagt
gcccgattattagaatcccaccaggtggcggtgattcctggagcggcgtttggagccgat
gactgtgtgcgtttttcctacgctaccgatatggacaccattaaacagggtttggccgag
ttagagcggtttgtcagcactttggcttga

DBGET integrated database retrieval system