KEGG   Synechococcus sp. UTEX 2973: M744_04385Help
Entry
M744_04385        CDS       T03581                                 

Definition
(GenBank) D-alanine--D-alanine ligase
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
syu  Synechococcus sp. UTEX 2973
Pathway
syu00473  D-Alanine metabolism
syu00550  Peptidoglycan biosynthesis
syu01100  Metabolic pathways
syu01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:syu00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    M744_04385
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    M744_04385
 09160 Human Diseases
  09175 Drug resistance: Antimicrobial
   01502 Vancomycin resistance
    M744_04385
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:syu01011]
    M744_04385
Enzymes [BR:syu01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     M744_04385
Peptidoglycan biosynthesis and degradation proteins [BR:syu01011]
 Precursor biosynthesis
  Amino acid ligase
   M744_04385
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N CPSase_L_D2 ATP-grasp ATP-grasp_4 ATPgrasp_YheCD DUF4138
Motif
Other DBs
NCBI-ProteinID: AJD57132
LinkDB All DBs
Position
complement(820598..821641)
Genome map
AA seq 347 aa AA seqDB search
MAAQKVGLLFGGRSGEHEVSIRSAAAIASALADPSNRDRYQVLPFYIDKEGGWHSGETAA
QVLANQKPLFVEEPSDRWQFPADCRDVEVWFPILHGPNGEDGTIQGLLTLMQRPFVGSGV
LGSALGMDKIAMKQAFAQASLPQVAYVAVNRSQVFSDPCRYTSLLEQIETELGYPCFVKP
ANLGSSVGIAKVRDRAELEAALDQAAALDRRLIIEAAIDNPREVECAVLGNDYPQASILG
EITYDSDFYDYETKYTDGKAQLLIPAQLSAELQQKLQELAIAAFQAVDASGLSRLDFFLD
SQGQIFINEINTLPGFTALSMYPQLWAASGVAFPDLVHRLIQLALER
NT seq 1044 nt NT seq  +upstreamnt  +downstreamnt
gtggcagcacaaaaggtcgggttattgtttggcgggcgatcaggcgaacatgaagtctcg
atccgctcggcggcggcgatcgcctctgctctggctgatcccagcaatcgcgatcgctac
caagtcctgcccttctacatcgacaaagaaggcggctggcacagtggtgaaaccgcagcc
caagtcttagccaaccaaaagccactcttcgttgaggaaccgagcgatcgctggcaattt
ccagcagactgccgcgacgtcgaagtctggttcccgatcctgcacggccccaacggtgaa
gatggcacgattcaagggctgctgaccctgatgcagcgtccctttgtcggatctggcgtt
ctcgggtcagccttgggcatggacaagatcgctatgaaacaggcttttgcccaagcgagt
ttgccgcaagtcgcctacgttgccgtcaatcgcagtcaagtcttctcggatccctgccgc
tacacaagtttgctggagcagattgaaacggagctgggctatccctgttttgtgaagccc
gccaacctgggatcgtcggttgggatcgccaaagtccgcgatcgcgctgaactggaagcc
gccctcgatcaagctgctgccctcgatcgccgtttaattatcgaagctgcgatcgacaat
cctcgcgaagtcgaatgcgctgtgctcggcaacgactatccccaagcctcaattctgggc
gaaatcacctacgacagcgatttctacgactacgaaaccaagtacaccgatggcaaggcg
caactgttgatccccgcgcaactttcggcggaattgcagcagaaactgcaagaactcgcg
atcgccgccttccaagccgtcgatgcatctggcctcagtcgcttggattttttcttggat
agccaaggtcaaattttcatcaacgaaatcaacactctgccgggcttcacagctttgagt
atgtatccccagctctgggcagcgagtggcgtggccttccccgatcttgtccatcggctg
attcaactggctctggagcgctag

DBGET integrated database retrieval system