KEGG   Synechococcus sp. UTEX 2973: M744_09410Help
Entry
M744_09410        CDS       T03581                                 

Definition
(GenBank) 2-succinyl-5-enolpyruvyl-6-hydroxy-3-cyclohexene-1-carboxylate synthase
  KO
K02551  2-succinyl-5-enolpyruvyl-6-hydroxy-3-cyclohexene-1-carboxylate synthase [EC:2.2.1.9]
Organism
syu  Synechococcus sp. UTEX 2973
Pathway
syu00130  Ubiquinone and other terpenoid-quinone biosynthesis
syu01100  Metabolic pathways
syu01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:syu00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00130 Ubiquinone and other terpenoid-quinone biosynthesis
    M744_09410
Enzymes [BR:syu01000]
 2. Transferases
  2.2  Transferring aldehyde or ketonic groups
   2.2.1  Transketolases and transaldolases
    2.2.1.9  2-succinyl-5-enolpyruvyl-6-hydroxy-3-cyclohexene-1-carboxylic-acid synthase
     M744_09410
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TPP_enzyme_N TPP_enzyme_M_2 TPP_enzyme_C
Motif
Other DBs
NCBI-ProteinID: AJD58032
LinkDB All DBs
Position
1773767..1775491
Genome map
AA seq 574 aa AA seqDB search
MPIDPRNLNTLWSSVLAESFVRLGLQTVVICPGSRSAPLAIAFAEHPEIDAIPILDERSA
GFFALGRAKASHRPVALICSSGTAGANFYPAVIEAKESGVPLLVITADRPPELRQCHAGQ
AIDQLRLFGSYALWEAELALPVLDLGLLRYLRQTAQQAWQQALRGGPVHLNQPLREPLAP
IADPATQTWLAQQWPGENFFAELLTAVPTPQIQQPLPPLPSQGLITVGPIAPEDPAAFVQ
AIAQLSAHLGWPVLSDAVTPLRQFADHCPRLISSYDLILRQPHWRASLQPEAVLQIGELP
TSKELRLWLTEQTCPRWIVSPRPENFDPLHGSSHHLPVTVEAIAIPATIAPASDYSRQWQ
QAETAVQAAIAQHLAQVPDLTEPGIARLLSQHLPAQTPIFVANSTPIRDLEWFWLANDQR
RSLYCSRGANGIDGTLSTAIGIAHQNRPSVLITGDLSLLHDSNGFLQRSQLQGHLTVVLI
DNSGGGIFELLPIRDCGPSFEPFVATPQTVDFAALCQAYGVDYQAIATEAELIKAIQTLP
TSGIRVLHLFTDRRQNAAWRRALFAELAAIPSQS
NT seq 1725 nt NT seq  +upstreamnt  +downstreamnt
atgccgatcgaccctcgcaacctcaatactctttggtcttctgttctagcggagagcttt
gtgaggctgggactgcaaaccgtggtgatctgcccaggctcccgctcggcaccgctggca
atcgcttttgcagagcatccagaaatcgatgccatcccgattttggatgagcgttcggct
ggtttcttcgccctagggcgagcaaaagccagtcaccgacccgttgccttgatctgttcc
tctggaactgcgggtgccaacttctatccggcagtgatcgaagccaaagagagtggcgtg
ccgctactggtcatcaccgccgatcgcccaccagagctgcgtcagtgtcatgccggccag
gcgatcgatcagctgaggctcttcggcagctatgcgctttgggaggccgaactggccttg
cctgtgctggatttaggtttactgcgctacctgcgacaaacggctcaacaggcttggcaa
caggcactgcggggcggaccggttcatctcaatcaaccgttgcgggaacccctcgcgccg
atcgccgatcccgccactcaaacttggttagcgcaacagtggcccggcgagaatttcttc
gcagaattgcttacagctgtacccaccccacagattcagcaaccgctaccgccactaccc
tcacagggactgattactgtgggcccgatcgccccagaagatccggccgcgtttgtgcaa
gcgatcgcacagctttcagcgcatctgggctggccagtgctcagtgatgctgtgacgccc
ttgcgacagttcgctgatcactgtccacggttgatcagtagctatgacttgatcctgcgg
caaccccactggcgagccagtctccagcctgaagcagtgctgcaaattggtgaattgccc
accagcaaggaactgcggctgtggttgactgagcaaacctgcccccgctggattgtgtcg
ccccgtccagagaattttgatcccctgcacggatccagccatcatctgccggtgacggta
gaggcgatcgctatcccagccacaatcgcacctgccagtgactatagtcgccagtggcag
caagcagagactgctgttcaagccgcgatcgcccagcatctagcccaggttcctgacctg
acagaacctggcattgctcggttgctcagtcagcatctacctgcgcaaacgccgatcttt
gtggccaatagtacgccgattcgcgatctggaatggttttggctggcgaatgatcagcgg
cgatcgctctactgcagtcgcggagccaatggcattgatggcacgctctccaccgcgatc
gggattgcccatcaaaatcgccccagtgtgctgattaccggtgatctctcgctcttgcat
gacagcaatggctttctgcagcgatcgcagttgcaggggcatctcaccgtggtgttgatc
gataattccggcggcggcatctttgagttgctgccgattcgcgactgtggacccagtttt
gagccctttgtagccactccgcaaacggtggactttgctgcactttgccaagcctacggc
gtcgattatcaggcgatcgccactgaggcggagctgatcaaagcgattcaaaccctgccg
acatctggcatccgagtcctccatctgttcaccgatcgccgacaaaatgccgcttggcga
cgcgccttatttgccgagctagcggcgatccccagccagagctga

DBGET integrated database retrieval system