KEGG   Synechococcus sp. UTEX 2973: M744_11335
Entry
M744_11335        CDS       T03581                                 

Definition
(GenBank) branched-chain alpha-keto acid dehydrogenase subunit E2
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
syu  Synechococcus sp. UTEX 2973
Pathway
syu00010  Glycolysis / Gluconeogenesis
syu00020  Citrate cycle (TCA cycle)
syu00620  Pyruvate metabolism
syu01100  Metabolic pathways
syu01110  Biosynthesis of secondary metabolites
syu01120  Microbial metabolism in diverse environments
syu01200  Carbon metabolism
Module
syu_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:syu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    M744_11335
   00020 Citrate cycle (TCA cycle)
    M744_11335
   00620 Pyruvate metabolism
    M744_11335
Enzymes [BR:syu01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     M744_11335
SSDB
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding MadL Aminotran_1_2
Other DBs
NCBI-ProteinID: AJD58385
LinkDB
Position
complement(2183691..2184986)
AA seq 431 aa
MIHEVFMPALSSTMTEGKIVEWVKAPGDRVEKGETVLIVESDKADMDVESFYEGYLATII
VPAGGNAPVGEAIALIAETEAEIEVAKQQAAGAGSAAATPATPAATAAPEPVAVSPEPVA
APTATRSDRLVASPRAKKLAKSLGVDLASLTGSGPHGRIVAADVEAAAGVTAKPAIATPV
APAVVTAPVAAPVATAPAAPAPTPAIAPGQFVPYSTFQQAVVRNMEASLNVPVFRVGYTI
TTDAIDSLAKQLKPKGVTITVLLAKAVAATLAKHPLLNARATETGVQYNEAINVAIAVAM
DDGGLLTPVLGRADQTDLYSLARNWKDLVARSRTKQLKPEEYTTGTFTLSNLGMFGVDRF
DAILPPGTGAILAIGASKPTLVATADGLFGVKRQMQVNLTCDHRHIYGAHAAAFLKDLAD
LIENRPESLTL
NT seq 1296 nt   +upstreamnt  +downstreamnt
atgatccacgaagtcttcatgcccgccctcagctccactatgaccgagggcaagatcgtc
gagtgggtgaaggctccgggcgatcgtgtcgagaaaggtgaaacagtcctgatcgtcgag
tcggacaaagccgacatggacgtggaatctttctatgaaggctacctcgcgacgattatt
gtgccggcaggcggcaatgctcccgtgggcgaagcgatcgctctgattgcagaaactgaa
gccgaaattgaagttgcgaagcaacaggcagccggtgctggttccgctgcagcgacccct
gcaacccctgctgctacggcggcacccgaacccgtcgctgtgagccctgaacctgtcgct
gctcctacagcaacccgcagcgatcgcttggttgcctccccgcgtgccaaaaaactcgcc
aagagcttgggcgttgacctcgctagccttaccggcagtggtccccacggtcgaattgtg
gcagccgatgtcgaagccgccgcaggagttactgccaaacccgcgatcgctacccctgtg
gctcctgccgttgtcaccgcaccggttgctgctcccgttgctacggctcctgctgccccc
gcgccaactcccgcgatcgcgccgggtcagttcgtgccctacagcaccttccagcaggcc
gtggttcgcaacatggaagcgagcctcaacgtgccggtcttccgcgtcggttacacgatc
accaccgatgcgatcgatagtttggccaagcagctcaagcccaaaggcgtgacaatcacg
gttttgctggccaaagccgtcgctgcaaccctcgccaagcatcccttgctcaatgctcgg
gcgacagaaactggcgtccagtacaacgaagccatcaacgtggcgatcgcggtggctatg
gatgatggcggtctgctgacccccgtactgggtcgtgctgatcaaaccgatctctatagc
ttggctcgcaactggaaggatctcgtggcgcgatcgcgcaccaagcaactcaaacccgag
gaatacaccaccggcacctttaccctctccaatctagggatgtttggtgtcgatcgcttc
gatgcgattctgccgccgggcaccggtgcgattctggcgattggggcttccaaaccgacc
ctcgtggccacggctgacggtctgtttggcgtcaagcggcagatgcaagttaacctcacc
tgtgatcaccgccacatctacggcgctcatgcggctgccttcctcaaggacttggccgac
ctgattgaaaaccgccccgaaagcctgaccctctaa

DBGET integrated database retrieval system