KEGG   Synechococcus sp. UTEX 2973: M744_11335Help
Entry
M744_11335        CDS       T03581                                 

Definition
(GenBank) branched-chain alpha-keto acid dehydrogenase subunit E2
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
syu  Synechococcus sp. UTEX 2973
Pathway
syu00010  Glycolysis / Gluconeogenesis
syu00020  Citrate cycle (TCA cycle)
syu00620  Pyruvate metabolism
syu01100  Metabolic pathways
syu01110  Biosynthesis of secondary metabolites
syu01120  Microbial metabolism in diverse environments
syu01130  Biosynthesis of antibiotics
syu01200  Carbon metabolism
Module
syu_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:syu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    M744_11335
   00020 Citrate cycle (TCA cycle)
    M744_11335
   00620 Pyruvate metabolism
    M744_11335
Enzymes [BR:syu01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     M744_11335
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding MadL Aminotran_1_2
Motif
Other DBs
NCBI-ProteinID: AJD58385
LinkDB All DBs
Position
complement(2183691..2184986)
Genome map
AA seq 431 aa AA seqDB search
MIHEVFMPALSSTMTEGKIVEWVKAPGDRVEKGETVLIVESDKADMDVESFYEGYLATII
VPAGGNAPVGEAIALIAETEAEIEVAKQQAAGAGSAAATPATPAATAAPEPVAVSPEPVA
APTATRSDRLVASPRAKKLAKSLGVDLASLTGSGPHGRIVAADVEAAAGVTAKPAIATPV
APAVVTAPVAAPVATAPAAPAPTPAIAPGQFVPYSTFQQAVVRNMEASLNVPVFRVGYTI
TTDAIDSLAKQLKPKGVTITVLLAKAVAATLAKHPLLNARATETGVQYNEAINVAIAVAM
DDGGLLTPVLGRADQTDLYSLARNWKDLVARSRTKQLKPEEYTTGTFTLSNLGMFGVDRF
DAILPPGTGAILAIGASKPTLVATADGLFGVKRQMQVNLTCDHRHIYGAHAAAFLKDLAD
LIENRPESLTL
NT seq 1296 nt NT seq  +upstreamnt  +downstreamnt
atgatccacgaagtcttcatgcccgccctcagctccactatgaccgagggcaagatcgtc
gagtgggtgaaggctccgggcgatcgtgtcgagaaaggtgaaacagtcctgatcgtcgag
tcggacaaagccgacatggacgtggaatctttctatgaaggctacctcgcgacgattatt
gtgccggcaggcggcaatgctcccgtgggcgaagcgatcgctctgattgcagaaactgaa
gccgaaattgaagttgcgaagcaacaggcagccggtgctggttccgctgcagcgacccct
gcaacccctgctgctacggcggcacccgaacccgtcgctgtgagccctgaacctgtcgct
gctcctacagcaacccgcagcgatcgcttggttgcctccccgcgtgccaaaaaactcgcc
aagagcttgggcgttgacctcgctagccttaccggcagtggtccccacggtcgaattgtg
gcagccgatgtcgaagccgccgcaggagttactgccaaacccgcgatcgctacccctgtg
gctcctgccgttgtcaccgcaccggttgctgctcccgttgctacggctcctgctgccccc
gcgccaactcccgcgatcgcgccgggtcagttcgtgccctacagcaccttccagcaggcc
gtggttcgcaacatggaagcgagcctcaacgtgccggtcttccgcgtcggttacacgatc
accaccgatgcgatcgatagtttggccaagcagctcaagcccaaaggcgtgacaatcacg
gttttgctggccaaagccgtcgctgcaaccctcgccaagcatcccttgctcaatgctcgg
gcgacagaaactggcgtccagtacaacgaagccatcaacgtggcgatcgcggtggctatg
gatgatggcggtctgctgacccccgtactgggtcgtgctgatcaaaccgatctctatagc
ttggctcgcaactggaaggatctcgtggcgcgatcgcgcaccaagcaactcaaacccgag
gaatacaccaccggcacctttaccctctccaatctagggatgtttggtgtcgatcgcttc
gatgcgattctgccgccgggcaccggtgcgattctggcgattggggcttccaaaccgacc
ctcgtggccacggctgacggtctgtttggcgtcaagcggcagatgcaagttaacctcacc
tgtgatcaccgccacatctacggcgctcatgcggctgccttcctcaaggacttggccgac
ctgattgaaaaccgccccgaaagcctgaccctctaa

DBGET integrated database retrieval system