KEGG   Synechococcus sp. UTEX 2973: M744_12745Help
Entry
M744_12745        CDS       T03581                                 

Definition
(GenBank) superoxide dismutase
  KO
K04564  superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
syu  Synechococcus sp. UTEX 2973
Brite
Enzymes [BR:syu01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     M744_12745
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Fe_C Sod_Fe_N Phage_portal
Motif
Other DBs
NCBI-ProteinID: AJD58638
LinkDB All DBs
Position
complement(2468708..2469313)
Genome map
AA seq 201 aa AA seqDB search
MSYELPALPFDYTALAPYITKETLEFHHDKHHAAYVNNYNNAVKDTDLDGQPIEAVIKAI
AGDASKAGLFNNAAQAWNHSFYWNSIKPNGGGAPTGALADKIAADFGSFENFVTEFKQAA
ATQFGSGWAWLVLDNGTLKITKTGNADTPIAHGQTPLLTIDVWEHAYYLDYQNRRPDYIS
TFVEKLANWDFASANYAAAIA
NT seq 606 nt NT seq  +upstreamnt  +downstreamnt
atgtcctacgaattgccagcattgccctttgactacacggcactggcgccttacatcacc
aaggaaacgctggagttccaccacgataagcaccacgcggcctacgtcaataactacaac
aacgccgtcaaagacaccgacctcgatggccagccgatcgaagccgtgatcaaagcgatc
gcgggtgacgctagcaaagccggtctgttcaacaatgcggctcaagcttggaaccacagc
ttttactggaactcgatcaagcccaatggcggtggcgctcccaccggcgcgttggccgac
aaaatcgccgctgacttcggcagtttcgagaacttcgtgaccgagttcaaacaagccgca
gcaacccagttcggcagcggctgggcttggttggtgctggacaatggcaccctcaaaatc
accaaaaccggcaacgccgacaccccgattgcccatggtcaaaccccgctactgaccatc
gatgtctgggaacacgcttactacctcgactaccaaaaccgtcgtcccgactacatcagc
accttcgttgagaagctggcgaactgggacttcgcctctgccaactacgcagctgcgatc
gcttag

DBGET integrated database retrieval system