KEGG   Synechococcus sp. PCC 73109: AWQ23_00690
Entry
AWQ23_00690       CDS       T05693                                 

Definition
(GenBank) branched-chain alpha-keto acid dehydrogenase subunit E2
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
syv  Synechococcus sp. PCC 73109
Pathway
syv00010  Glycolysis / Gluconeogenesis
syv00020  Citrate cycle (TCA cycle)
syv00620  Pyruvate metabolism
syv01100  Metabolic pathways
syv01110  Biosynthesis of secondary metabolites
syv01120  Microbial metabolism in diverse environments
syv01200  Carbon metabolism
Module
syv_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:syv00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    AWQ23_00690
   00020 Citrate cycle (TCA cycle)
    AWQ23_00690
   00620 Pyruvate metabolism
    AWQ23_00690
Enzymes [BR:syv01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     AWQ23_00690
SSDB
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding PASTA
Other DBs
NCBI-ProteinID: AMA07952
LinkDB
Position
127924..129228
AA seq 434 aa
MIHDIFMPALSSTMTEGKIVSWTKSPGDKVAKGETVVVVESDKADMDVESFNEGFLAAII
VDAGEEAPVGSAIALIAETEAEIPEAKQKAATLKGGSSVPAATPEPTPAAPSPEPAPVVA
APAPTPATPTPAPVVNDGRIIASPRAKKLAKEFGVDLKTVPGSGPHGRIVAEDVEKAAGK
APTIAPAAVSTPAPTTSKPAAPAPAPVAVTPGEVVPLNTLQQAVVRNMNASLNVPTFHVS
YDITTDALDALYKQIKSKGVTMTGLLAKAVAVTLQKHPVVNASFGDNAIQYSSGINVAVA
VAMPDGGLITPVLQNADQMDIYSLSRKWKDLVDRARLKQLQPDEYSTGTFTLSNLGMFGV
SSFDAILPPGQGSILAIGGAQPKVVATPDGLFGVKKQMTVNITCDHRIIYGADAAAFLKD
LADLIENNTHSLTL
NT seq 1305 nt   +upstreamnt  +downstreamnt
atgattcacgatattttcatgcccgccctcagttctacgatgaccgaaggtaaaatcgtc
tcttggactaagtccccgggagataaagtcgctaaaggtgaaaccgttgtcgtggtggaa
tctgacaaagccgatatggacgttgagtcttttaacgaagggtttctcgcagcgattatc
gttgatgcgggggaagaagcaccagtgggttcggcgatcgcccttattgctgaaaccgaa
gcagaaattccagaagccaaacaaaaagccgcgactctgaaaggggggagtagtgttcct
gctgctacacctgaacccacacctgctgcacctagtccagaaccggctcccgttgtggca
gccccggcgcctacacctgcaaccccgacccccgcaccagtggtcaacgatggcagaatt
attgcttctccgagggcgaaaaaactcgccaaagaatttggcgttgatcttaaaacagtg
cctggttctggcccccacggtcgaattgtcgccgaagatgtcgaaaaagccgctggtaaa
gcacctactattgcccctgctgccgtatcaactccagcgccgacaaccagtaagcctgcc
gccccagcgccagctcccgtcgccgttactcctggtgaagttgtcccgctgaatacgttg
caacaggcggttgtgcggaatatgaatgccagcctgaatgtacctaccttccacgtgtcc
tatgacatcacgaccgatgccctagatgccctctacaagcaaattaagagcaagggcgtc
accatgacgggtctattggcgaaggccgtggctgtgaccctccagaaacacccagtggtt
aatgccagctttggggataatgcgattcaatacagcagtggtattaatgtggcggtggcc
gttgcgatgcccgatggcggcctgattacccctgtgctgcaaaatgccgatcaaatggat
atctattccctttcccgcaagtggaaagatttggtagaccgggcgcgcctcaagcaactg
cagcccgatgagtacagcactggcacctttaccctctctaacctaggcatgtttggggtc
agcagttttgatgcgattttaccccccggccaaggttcaatcctcgcgattgggggggct
cagcctaaagtcgttgcgacgcccgacggtttatttggtgtgaaaaagcaaatgaccgtc
aatatcacctgcgaccaccgcattatttatggtgctgatgcggcggcattccttaaggat
ctagccgacttgattgaaaataacacacacagtctgaccctttag

DBGET integrated database retrieval system