KEGG   Synechococcus sp. PCC 73109: AWQ23_00690Help
Entry
AWQ23_00690       CDS       T05693                                 

Definition
(GenBank) branched-chain alpha-keto acid dehydrogenase subunit E2
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
syv  Synechococcus sp. PCC 73109
Pathway
syv00010  Glycolysis / Gluconeogenesis
syv00020  Citrate cycle (TCA cycle)
syv00620  Pyruvate metabolism
syv01100  Metabolic pathways
syv01110  Biosynthesis of secondary metabolites
syv01120  Microbial metabolism in diverse environments
syv01130  Biosynthesis of antibiotics
syv01200  Carbon metabolism
Module
syv_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:syv00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    AWQ23_00690
   00020 Citrate cycle (TCA cycle)
    AWQ23_00690
   00620 Pyruvate metabolism
    AWQ23_00690
Enzymes [BR:syv01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     AWQ23_00690
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding PASTA
Motif
Other DBs
NCBI-ProteinID: AMA07952
LinkDB All DBs
Position
127924..129228
Genome map
AA seq 434 aa AA seqDB search
MIHDIFMPALSSTMTEGKIVSWTKSPGDKVAKGETVVVVESDKADMDVESFNEGFLAAII
VDAGEEAPVGSAIALIAETEAEIPEAKQKAATLKGGSSVPAATPEPTPAAPSPEPAPVVA
APAPTPATPTPAPVVNDGRIIASPRAKKLAKEFGVDLKTVPGSGPHGRIVAEDVEKAAGK
APTIAPAAVSTPAPTTSKPAAPAPAPVAVTPGEVVPLNTLQQAVVRNMNASLNVPTFHVS
YDITTDALDALYKQIKSKGVTMTGLLAKAVAVTLQKHPVVNASFGDNAIQYSSGINVAVA
VAMPDGGLITPVLQNADQMDIYSLSRKWKDLVDRARLKQLQPDEYSTGTFTLSNLGMFGV
SSFDAILPPGQGSILAIGGAQPKVVATPDGLFGVKKQMTVNITCDHRIIYGADAAAFLKD
LADLIENNTHSLTL
NT seq 1305 nt NT seq  +upstreamnt  +downstreamnt
atgattcacgatattttcatgcccgccctcagttctacgatgaccgaaggtaaaatcgtc
tcttggactaagtccccgggagataaagtcgctaaaggtgaaaccgttgtcgtggtggaa
tctgacaaagccgatatggacgttgagtcttttaacgaagggtttctcgcagcgattatc
gttgatgcgggggaagaagcaccagtgggttcggcgatcgcccttattgctgaaaccgaa
gcagaaattccagaagccaaacaaaaagccgcgactctgaaaggggggagtagtgttcct
gctgctacacctgaacccacacctgctgcacctagtccagaaccggctcccgttgtggca
gccccggcgcctacacctgcaaccccgacccccgcaccagtggtcaacgatggcagaatt
attgcttctccgagggcgaaaaaactcgccaaagaatttggcgttgatcttaaaacagtg
cctggttctggcccccacggtcgaattgtcgccgaagatgtcgaaaaagccgctggtaaa
gcacctactattgcccctgctgccgtatcaactccagcgccgacaaccagtaagcctgcc
gccccagcgccagctcccgtcgccgttactcctggtgaagttgtcccgctgaatacgttg
caacaggcggttgtgcggaatatgaatgccagcctgaatgtacctaccttccacgtgtcc
tatgacatcacgaccgatgccctagatgccctctacaagcaaattaagagcaagggcgtc
accatgacgggtctattggcgaaggccgtggctgtgaccctccagaaacacccagtggtt
aatgccagctttggggataatgcgattcaatacagcagtggtattaatgtggcggtggcc
gttgcgatgcccgatggcggcctgattacccctgtgctgcaaaatgccgatcaaatggat
atctattccctttcccgcaagtggaaagatttggtagaccgggcgcgcctcaagcaactg
cagcccgatgagtacagcactggcacctttaccctctctaacctaggcatgtttggggtc
agcagttttgatgcgattttaccccccggccaaggttcaatcctcgcgattgggggggct
cagcctaaagtcgttgcgacgcccgacggtttatttggtgtgaaaaagcaaatgaccgtc
aatatcacctgcgaccaccgcattatttatggtgctgatgcggcggcattccttaaggat
ctagccgacttgattgaaaataacacacacagtctgaccctttag

DBGET integrated database retrieval system