KEGG   Synechococcus sp. PCC 73109: AWQ23_01375Help
Entry
AWQ23_01375       CDS       T05693                                 

Definition
(GenBank) superoxide dismutase
  KO
K04564  superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
syv  Synechococcus sp. PCC 73109
Brite
Enzymes [BR:syv01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     AWQ23_01375
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Fe_C Sod_Fe_N
Motif
Other DBs
NCBI-ProteinID: AMA08077
LinkDB All DBs
Position
281533..282132
Genome map
AA seq 199 aa AA seqDB search
MGYELPALPYDYTALEPHISKSTLEFHHDKHHASYVSKYNDAVAGTDMDSKSIEDVIKAV
AADPAKAGLFNNAAQAWNHSFYWNCMKPGGGGQPTGALADKINADFGSFDKFVEAFKTAG
GTQFGSGWAWLVLDNGTLKVTKTGNAGNPMTEGQTPLLTMDVWEHAYYLDYQNRRPDYIN
TFLTSLVNWDFVAANLAAA
NT seq 600 nt NT seq  +upstreamnt  +downstreamnt
atgggatacgaactacctgcattaccctacgattacactgccctcgaaccccacatctcg
aagagcaccttagaatttcaccatgataagcaccatgcgagctatgtctccaagtacaac
gatgccgtagctggcaccgacatggatagcaaaagtatcgaagacgtaatcaaagccgta
gctgcagatcccgccaaagcaggtttgtttaataacgctgcccaagcgtggaaccacagc
ttctactggaactgcatgaagcccggtggcggtggtcaacccactggtgccctcgccgac
aaaatcaacgccgacttcggtagtttcgataaattcgttgaggctttcaaaaccgctggt
ggcacccagtttggtagtggttgggcttggctcgtcctcgacaatggcaccctcaaggtc
actaaaactggcaatgctggcaaccctatgaccgaaggccaaactcccctcctcaccatg
gacgtttgggaacacgcctactacctcgactaccaaaaccgtcgccccgactacatcaac
accttcctcaccagtcttgtgaactgggatttcgtggcggctaacctcgcagcggcctaa

DBGET integrated database retrieval system