KEGG   Synechococcus sp. PCC 73109: AWQ23_10705Help
Entry
AWQ23_10705       CDS       T05693                                 

Definition
(GenBank) alpha-glucan phosphorylase
  KO
K00688  glycogen phosphorylase [EC:2.4.1.1]
Organism
syv  Synechococcus sp. PCC 73109
Pathway
syv00500  Starch and sucrose metabolism
syv01100  Metabolic pathways
syv01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:syv00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    AWQ23_10705
Enzymes [BR:syv01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.1  glycogen phosphorylase
     AWQ23_10705
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF3417 Phosphorylase Glyco_transf_5
Motif
Other DBs
NCBI-ProteinID: AMA09752
LinkDB All DBs
Position
2218038..2220602
Genome map
AA seq 854 aa AA seqDB search
MKPTHKFQVKAVLPPVLEPLRRLAHNIHWDWNVAAKSLFVRLDPDLWQQTSHNPVAMLGR
VDQARLDELAKDDGFIAHMERAIEQLDDYLQQHTWYHKARGETKGKECYAYFCAEYGLSY
CLPIYSGGLGILAGDHLKSASDLGLPLVAVGLLYQEGYFAQYLNHDGWQQEEYPINDFYN
MPLHLEKDDQGNELIIEVEFPGRMIYARVWRIDVGTVPLYMLDTNIEQNTNPYDHDITDE
LYGGDRDLRLHQEILLGIGGVRMLEKLGYKPTVYHMNEGHSAFLILERIRKLMQEQGLTF
RHAQQFALSTQMFTTHTPVSAGFDLFSPEQTLHYVGHYAEKFGLSPDRFLGLGRENTGDL
EAPFNMAIFALKHSAFINGVSQLHGQVSREMFHSLWPDFPRDEVGITSITNGVHARSVTA
PATQDLYDRYLAPTWDEAPAESHIWEKVSTIPNEELWRNHERQRSDLVVYIRQHLAKQLQ
KQGATEAAIAKARQVLKPNLLTIGFARRFATYKRANLFLYDIERIKKIILGNPERQVQFV
IAGKAHPKDIPGKELIRNIIHTVQEEGLEDYVVFLPNYNIHIARKMVAGCDVWLNTPRRP
REASGTSGMKAAMNGLPNLSVLDGWWDEADYTRTGWAIGHGEIYDDQDYQDRVEASALYE
LLEKEIVPLFYTRNSFDVPEGWVNKMKEAIRLNCPMFNTSRMLRDYAQKAYFKLSDRHFE
LSDNRYQAVQELADWKSQLFKAWYNIRVEAFDVGESAEIDIQQPVHVKAILDLAALTPDD
LAVQIYLGTINDQDELINGESYPMTFQGLTTDQKAIYQGVVQYKKSGYQGMALRILPHHR
HLDDATEPRLIRWA
NT seq 2565 nt NT seq  +upstreamnt  +downstreamnt
atgaaaccgacccacaagtttcaggtcaaagccgttttaccccctgtcctggaaccccta
cgccgcctcgcccataacatccactgggattggaatgtcgccgcaaaaagtctctttgtt
cgcctcgatccagacctatggcagcagacgagccacaatccggtggcgatgttgggtcgc
gttgaccaagcccgcctcgatgaactagccaaggatgacggttttatcgcccatatggaa
cgggccattgaacagctcgatgactacctccaacaacacacttggtaccacaaagcacgg
ggcgaaaccaaagggaaagaatgctatgcctatttctgtgcggagtatggcctcagctac
tgcctgccgatttattccgggggattggggattcttgcgggggatcacctcaaatccgcc
agtgatctcggtttacccctagtggccgttggtttactgtaccaggagggctatttcgcc
cagtatctcaaccatgacggctggcaacaggaagaatatccgatcaatgatttctacaat
atgcccctccatttagaaaaagatgaccagggaaatgaactgatcattgaggtggaattt
ccggggcggatgatctatgcacgggtttggcgcatcgatgtggggacggtgcccctctat
atgttagataccaacattgagcagaataccaacccctacgaccacgacattaccgatgaa
ctgtatggaggcgatcgcgatctccggctccaccaagagatcctcctaggcatcggtggc
gtgcgcatgctcgaaaaactaggctacaaaccgacggtctaccacatgaacgaaggccac
agcgcctttttgatcctggagcgcatccgcaaactcatgcaagagcagggcttaaccttc
cgccatgcccaacagtttgccctctcgacccaaatgtttacgacccacaccccggtttct
gctggtttcgatcttttttccccggagcaaaccctccattatgtgggccactatgccgaa
aaatttggcctctccccagaccgcttcctgggccttgggcgagaaaatactggagatcta
gaagcgccctttaatatggcgatctttgccctcaaacacagtgcttttatcaatggtgtg
agtcaactccatggccaagtttcccgggaaatgttccatagcttatggcctgattttccc
cgcgacgaagtcgggattacttcgatcacgaatggtgtccatgcccgcagcgtcaccgcc
cccgccacccaagatctctacgaccgctacctggcccccacctgggatgaagcccccgcc
gaaagccatatctgggaaaaagtgagcaccattcccaacgaagaactgtggcgtaaccac
gagcgtcaacgctccgatttggttgtctatattcggcagcacctcgccaagcaactgcaa
aaacaaggagccactgaagcggcgatcgccaaagcccgccaggtgctcaaacccaacctc
ctgaccatcggctttgcccgccgttttgccacctacaaacgggctaacctctttttgtat
gacattgaacgcattaaaaaaattatcctcggcaatccagagcgtcaggtgcaatttgtc
atcgccgggaaagcacacccaaaggatattccggggaaagagctgatccgcaacatcatc
cataccgtccaggaagaaggcctcgaagattacgttgtctttttacccaactacaatatc
cacattgcccgcaaaatggttgccgggtgcgatgtgtggctcaataccccccgacgaccc
cgggaagcctctggcacttccgggatgaaagcggcgatgaatggcttgccgaatttaagc
gtccttgatggctggtgggatgaggccgactatacccgcaccggttgggcgatcggccac
ggggaaatttacgatgatcaagattaccaagaccgggtagaagccagtgccctgtatgaa
ctgctagaaaaagaaattgtgccgctgttctatacgcgcaacagtttcgatgtccccgaa
ggctgggtcaataaaatgaaggaggccattcgcctcaattgccccatgtttaatacgtcg
cggatgctccgggactatgcccagaaggcttattttaaattgagcgatcgccattttgaa
ctcagcgacaatcgctaccaagccgtccaagaactcgccgattggaaatcccaactcttt
aaggcctggtacaatatccgcgtcgaagcctttgatgtcggggagtccgccgaaatcgac
attcaacagcccgtccatgtcaaagcaattctcgatctcgcggccctgaccccagacgat
ctggccgtgcaaatttacctcggcaccatcaatgaccaggacgaactcattaacggcgaa
agttaccctatgaccttccagggcctgaccaccgaccaaaaagcaatctaccaaggcgtc
gtgcaatacaaaaaaagtggctaccaaggcatggccctacgtattcttccccaccaccgt
cacctagatgatgctaccgaaccccggctcatccgttgggcctag

DBGET integrated database retrieval system