KEGG   Synechococcus sp. WH8102: SYNW0225Help
Entry
SYNW0225          CDS       T00144                                 

Gene name
fabI
Definition
(GenBank) enoyl-[acyl-carrier-protein] reductase
  KO
K00208  enoyl-[acyl-carrier protein] reductase I [EC:1.3.1.9 1.3.1.10]
Organism
syw  Synechococcus sp. WH8102
Pathway
syw00061  Fatty acid biosynthesis
syw00780  Biotin metabolism
syw01100  Metabolic pathways
syw01130  Biosynthesis of antibiotics
syw01212  Fatty acid metabolism
Module
syw_M00083  Fatty acid biosynthesis, elongation
syw_M00572  Pimeloyl-ACP biosynthesis, BioC-BioH pathway, malonyl-ACP => pimeloyl-ACP
Brite
KEGG Orthology (KO) [BR:syw00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    SYNW0225 (fabI)
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    SYNW0225 (fabI)
  09110 Biosynthesis of other secondary metabolites
   00333 Prodigiosin biosynthesis
    SYNW0225 (fabI)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:syw01004]
    SYNW0225 (fabI)
Enzymes [BR:syw01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.9  enoyl-[acyl-carrier-protein] reductase (NADH)
     SYNW0225 (fabI)
    1.3.1.10  enoyl-[acyl-carrier-protein] reductase (NADPH, Si-specific)
     SYNW0225 (fabI)
Lipid biosynthesis proteins [BR:syw01004]
 Fatty acid synthase
  Component type
   SYNW0225 (fabI)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: adh_short_C2 adh_short Enoyl_reductase
Motif
Other DBs
NCBI-ProteinID: CAE06740
CyanoBase: SYNW0225
CYORF: SYNW0225
UniProt: Q7U9M9
LinkDB All DBs
Position
224435..225217
Genome map
AA seq 260 aa AA seqDB search
MLLDLTGKKILVTGIANNRSIAWGIAQQLKAAGAELGITYLPDDKGRFEAKVRELTAPLE
PSLFLPLNVQDADQMAEVFGEIKAKWGVLDGLVHCLAFAGKEELIGDYSATTAEGFARSL
DISAYSLAPLCAHAKPLFSEKAGVITLSYLGAERAIPNYNVMGVAKAALEASVRYLAAEL
GPEKQVRVNAISAGPIRTLASSAIGGILDMIHNVEEKAPLRRTVTQMEVGGTAAFLLSDL
ASGISGQTIYVDAGYCVTGM
NT seq 783 nt NT seq  +upstreamnt  +downstreamnt
atgctgcttgatctcaccggcaagaagatcctcgtcaccggcatcgctaacaaccgttcg
atcgcctgggggattgctcagcagctcaaggcggccggtgctgagctcggcatcacctat
ctgcctgatgacaaaggccgcttcgaggccaaggtgcgcgaactcactgctcccctggag
cccagcctgttcctgcctctgaatgttcaggacgccgaccagatggctgaggttttcggc
gagatcaaggcgaagtggggcgttcttgatggtctggtgcactgcctggcctttgccggc
aaggaggagttgatcggcgactacagcgccaccacggcggaaggttttgcccgctcactg
gatataagcgcctattccctggccccgctctgtgcccatgccaagccgttgttcagcgag
aaggccggcgtgatcacgctgtcctatctcggcgctgagcgggcgattcccaactacaac
gtaatgggcgtcgccaaggcggctcttgaggcttccgttcgctatctggccgcagagctg
ggtcccgagaagcaggtgcgcgtcaacgccatcagcgccggccctatccgcaccctggcc
agctctgccattggcggcattctcgacatgatccacaacgtggaggaaaaggctcccctg
cgccgcaccgtgactcagatggaggtgggtggcaccgctgccttcctgctcagtgatctg
gccagcggcatctccggtcagaccatctacgtcgatgcgggctactgcgtcaccggcatg
tga

DBGET integrated database retrieval system