KEGG   Synechococcus sp. WH8102: SYNW0671Help
Entry
SYNW0671          CDS       T00144                                 

Definition
(GenBank) Putative dihydrolipoamide acetyltransferase component (E2) of pyruvate dehydrogenase complex
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
syw  Synechococcus sp. WH8102
Pathway
syw00010  Glycolysis / Gluconeogenesis
syw00020  Citrate cycle (TCA cycle)
syw00620  Pyruvate metabolism
syw01100  Metabolic pathways
syw01110  Biosynthesis of secondary metabolites
syw01120  Microbial metabolism in diverse environments
syw01130  Biosynthesis of antibiotics
syw01200  Carbon metabolism
Module
syw_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:syw00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SYNW0671
   00020 Citrate cycle (TCA cycle)
    SYNW0671
   00620 Pyruvate metabolism
    SYNW0671
Enzymes [BR:syw01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     SYNW0671
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding
Motif
Other DBs
NCBI-ProteinID: CAE07186
CyanoBase: SYNW0671
CYORF: SYNW0671
UniProt: Q7U8E9
LinkDB All DBs
Position
655000..656325
Genome map
AA seq 441 aa AA seqDB search
MATHDIFMPALSSTMTEGKIVEWLKQPGDKVGRGESVLVVESDKADMDVESFQDGYLAAV
LMPAGSTAPVGETIGLIVETEAEIADAQAKATSAAPAASAPAPTPAPAAVQAPAPTPAPT
QAPAAPAPVAASAAPVANGRVVASPRAKKLASQMGVDLSTVRGSGPHGRIQAEDVEQAGG
QPISVPRVAEGTAAAVAASAAPSAAAPSAPAGNSFGRPGDTVAFNTLQGAVNRNMEASLA
VPCFRVGYTITTDKLDAFSKLVKPKGVTMTALLAKAVAVTLARHPQVNAATTAAGMTYPA
EVNVAIAVAMEDGGLITPVLRNADRTDLYEMSRQWKDLVKRSRSKQLQPEEYSTGTFTLS
NLGMFGVDRFDAILPPGTGAILAVAASRPTVVAGKDGSIAVKRQMQVNLTADHRVIYGAD
GAAFLKDLAELIEHRPESLAL
NT seq 1326 nt NT seq  +upstreamnt  +downstreamnt
ttggcgacccacgacatcttcatgcctgccctcagctccaccatgactgagggcaagatc
gtggaatggctgaagcaaccgggcgacaaggtcggtcggggtgagtctgtgcttgtcgtc
gagtccgacaaggccgacatggacgttgagtccttccaggatggctatctcgctgcagtg
ctgatgccggccggcagtacagcgcccgttggtgaaaccatcggcctgatcgtggagacc
gaggcggagatcgctgacgcccaggccaaggccaccagtgctgcgcccgccgcctcagcc
cctgcccccacaccggcccccgcagctgtgcaggctccggccccgacaccagctccgact
caggccccagcagctccggcaccggtggctgcctcagcagcgccggtggcgaacggacgg
gtggtggccagtcctcgggccaagaagttggcctcccagatgggcgtggacctcagcacc
gtgcgcggcagcggcccccacggccgcattcaggctgaggacgtggaacaagctggtggt
cagcccatctctgtgccccgggttgctgagggcactgcagctgctgttgccgccagcgca
gccccgtcggcggcggcccccagtgcgccggcgggcaacagcttcgggcgtcccggcgac
accgtcgccttcaacaccctccagggtgcggtgaaccggaacatggaggccagcctcgct
gtgccgtgtttccgtgtcggatacaccatcaccaccgacaagctggatgcgttctccaag
ctggtgaaacccaagggcgtcacgatgacggcgctgctggccaaggccgttgccgtcacc
ctggctcgccatccccaggtgaatgccgccaccaccgcggcaggcatgacctatcccgct
gaagtgaacgtggccattgctgtggcgatggaagacggcggcttgatcaccccggtgctg
cgcaatgccgaccgcacggatctctacgagatgtcgcgccagtggaaagatctggtgaag
cggtcccgcagcaagcagcttcagcctgaggaatacagcaccggaaccttcaccctctcg
aacctgggaatgttcggtgtggaccgcttcgatgcgattcttccccccggtaccggagcg
atcctggcggtggcagcctcccgccccacggttgtggcgggcaaggatggttccatcgcc
gtgaaacggcagatgcaggtgaacctcaccgctgatcaccgggtgatttacggcgctgat
ggtgcggcattcctcaaggatctggcggagttgatcgaacatcgccccgagagcctggcg
ctctga

DBGET integrated database retrieval system