KEGG   Synechococcus sp. WH8102: SYNW1534Help
Entry
SYNW1534          CDS       T00144                                 

Definition
(GenBank) conserved hypothetical protein
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
syw  Synechococcus sp. WH8102
Pathway
syw00480  Glutathione metabolism
Brite
KEGG Orthology (KO) [BR:syw00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    SYNW1534
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:syw02000]
    SYNW1534
Enzymes [BR:syw01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     SYNW1534
Transporters [BR:syw02000]
 Other Transporters
  Pores ion channels [TC:1]
   SYNW1534
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GST_N_3 GST_N_2 GST_C_2 GST_N_4 GST_C_5 GST_N Glutaredoxin
Motif
Other DBs
NCBI-ProteinID: CAE08049
CyanoBase: SYNW1534
CYORF: SYNW1534
UniProt: Q7U607
LinkDB All DBs
Position
1477619..1478881
Genome map
AA seq 420 aa AA seqDB search
MDEAICPRSSMPLTSVPSEALSWSDLEGLTADESDRTQGPTNAQAVLRLFGQEASAVRVT
LYRDHHAWCPYCQKVWLWLEFKRIPYRIRKVTMRCYGSKEPWFLRRVPSGMLPALDLDGR
LITESDEILLQLEATFGPLGQPMTTPDVRSHRQLERLLFRAWCLWLCSPGLSPKDDQRAM
EQFRRVAGQFEQALRQSPGPFLDPAAPGTADLVFVPYVERMNASLAYYKGYRLRHEHPAI
DAWFRALEQLATYRGTQSDHHTHAHDLPPQMGGCWSNRSDAARTMADQIDRGDGLADDEA
CWDADHSINAAAIALGRVLRHRERLMERNPLGRSGFDQPLRCALTNLMGQGSPCPDHGSA
LALRHLRDRISVPRDMPLPAARLLRQALERTAALDGPGQPPPLPIRDRFDQDPAPFVSRP
NT seq 1263 nt NT seq  +upstreamnt  +downstreamnt
atggacgaggcgatctgtccccgatcctccatgccccttacatcggttccgtctgaagca
ctctcctggtcagacctggagggtctgaccgctgacgaatctgaccgcacgcaggggccg
accaatgcccaggcggttcttcgcttgttcggccaggaagcaagcgctgttcgcgtcacc
ctttaccgcgatcaccacgcctggtgcccgtactgccaaaaggtgtggttgtggttggag
ttcaaacggattccgtaccgcatccgcaaggtgacgatgcgctgctacggcagcaaagag
ccctggtttctgcgtcgtgttccgagcggaatgctgccggcccttgatctcgatggccgg
ctgatcaccgaaagcgatgagatcctcctgcaactggaggcgactttcgggcccctcggc
caaccgatgaccactccggacgtacgctcccatcggcagctggaacggctgctgttccgg
gcttggtgcctgtggctgtgctcccctggcctcagcccgaaggatgaccaacgggccatg
gagcaattccggcgcgtcgccgggcagttcgagcaagccctgcgtcaatcacccggcccc
tttcttgatcccgctgcaccgggaaccgctgacctggtgttcgtgccttatgtggaacgg
atgaacgcctcgttggcttactacaagggatatcgactccgccatgagcatccggccatc
gatgcctggttccgggctcttgaacagctggccacctatcgcggcacccagagcgatcac
cacacccatgcccacgaccttcccccacagatgggcggctgctggtccaaccgttccgac
gcggcacggaccatggccgatcaaatcgaccgcggtgacggactcgctgacgatgaagcc
tgctgggacgccgaccacagcatcaacgcggcggccattgccctcggccgggtgctgcgt
caccgcgagcgattgatggagcgaaacccactgggccgcagcggctttgatcaaccactc
cggtgtgctctcaccaacctgatgggccaaggctcaccgtgccccgaccacggcagtgcc
cttgcgcttcgccacctccgcgatcggatctcagtccctcgggacatgcccctgccggcc
gctcggctgttgcgtcaggcacttgaacggacggcagcactggacggtccgggtcagccg
ccaccactgccgatccgggaccgattcgatcaggacccagcgcctttcgtgagtcggcca
tag

DBGET integrated database retrieval system