KEGG   Synechococcus sp. WH8102: SYNW1717Help
Entry
SYNW1717          CDS       T00144                                 

Gene name
rbcS, cbbS
Definition
(GenBank) Ribulose bisphosphate carboxylase, small chain
  KO
K01602  ribulose-bisphosphate carboxylase small chain [EC:4.1.1.39]
Organism
syw  Synechococcus sp. WH8102
Pathway
syw00630  Glyoxylate and dicarboxylate metabolism
syw00710  Carbon fixation in photosynthetic organisms
syw01100  Metabolic pathways
syw01120  Microbial metabolism in diverse environments
syw01200  Carbon metabolism
Module
syw_M00165  Reductive pentose phosphate cycle (Calvin cycle)
syw_M00166  Reductive pentose phosphate cycle, ribulose-5P => glyceraldehyde-3P
syw_M00611  Oxygenic photosynthesis in plants and cyanobacteria
Brite
KEGG Orthology (KO) [BR:syw00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    SYNW1717 (rbcS)
  09102 Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    SYNW1717 (rbcS)
Enzymes [BR:syw01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.39  ribulose-bisphosphate carboxylase
     SYNW1717 (rbcS)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RuBisCO_small
Motif
Other DBs
NCBI-ProteinID: CAE08232
CyanoBase: SYNW1717
CYORF: SYNW1717
UniProt: P0A4S5
LinkDB All DBs
Position
complement(1651326..1651667)
Genome map
AA seq 113 aa AA seqDB search
MPFQSTVGDYQTVATLETFGFLPPMTQDEIYDQIAYIIAQGWSPLVEHVHPSNSMATYWS
YWKLPFFGEKDLNVVVSELEACHRAYPDHHVRIVGYDAYTQSQGACFVVFEGR
NT seq 342 nt NT seq  +upstreamnt  +downstreamnt
atgcctttccagagcaccgtgggtgactaccaaacagtcgccaccctggagaccttcggc
ttcctcccgccgatgacccaggacgagatctacgaccagatcgcgtacatcattgcccag
ggttggagcccgctcgttgagcacgtccatcccagcaactccatggccacctactggtcg
tattggaagctccccttcttcggtgagaaggatctgaacgttgtcgtcagtgagctcgag
gcttgccaccgcgcataccccgaccaccacgtgcgcatcgtcggttatgacgcttacacc
cagagccagggtgcatgcttcgtggttttcgaaggacgctga

DBGET integrated database retrieval system