KEGG   Synechococcus sp. WH7803: SynWH7803_0454Help
Entry
SynWH7803_0454    CDS       T00524                                 

Gene name
ppc, pepC
Definition
(GenBank) Phosphoenolpyruvate carboxylase
  KO
K01595  phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
syx  Synechococcus sp. WH7803
Pathway
syx00620  Pyruvate metabolism
syx00680  Methane metabolism
syx00710  Carbon fixation in photosynthetic organisms
syx01100  Metabolic pathways
syx01120  Microbial metabolism in diverse environments
syx01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:syx00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    SynWH7803_0454 (ppc)
  09102 Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    SynWH7803_0454 (ppc)
   00680 Methane metabolism
    SynWH7803_0454 (ppc)
Enzymes [BR:syx01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     SynWH7803_0454 (ppc)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPcase PEPcase_2 SpecificRecomb
Motif
Other DBs
NCBI-ProteinID: CAK22880
CyanoBase: SynWH7803_0454
CYORF: SynWH7803_0454
UniProt: A5GIW5
LinkDB All DBs
Position
complement(465305..468316)
Genome map
AA seq 1003 aa AA seqDB search
MIMTVSDPGGSSMSSSSAITPESEQAMAAVNDAPVGGQLLQQRLALVEDLWQTVLRSECP
AEQAERLLRMKQLSDPVLPEGNAVSSDALVSLIRDMDLSEAIAAARAFSLYFQLVNILEQ
RIEEDGYLESIVRSQDTAEQINPFTPPLATQTEPATFRELFERLRRLNVPPAQLETLLQE
LDIRLVFTAHPTEIVRHTVRHKQRRVASLLQQLEAQTESSTFEAGTIRLQLEEEIRLWWR
TDELHQFKPSVLDEVDYALHYFQQVLFDAMPQLRRRLSSALASSYPDVQLPPSSFCTFGS
WVGSDRDGNPSVTTDITWRTACYQRQLMLERYVSAVQGLRDQLSISMQWSQVSAPLLESL
EMDRLRFPEVYEERATRYRLEPYRLKLSFVLERLRLTQIRNQQLAEAGWRAPADGLLSSN
PEAPQSESLHYGSVAEFRSDLELIRTSLVSTDLTCEPLDTLLTQVHIFGFSLAGLDIRQE
STRHSDALDEVSRYLNPDQAYGDLNEQERVQWLLQELQTRRPLIPPSVSWSPTTEETVDV
FRTLHRLQDEFGSRICRTYVISMSHSVSDLLEVLLLSKEAGLVEPSAGHADLLVVPLFET
VEDLQRAPEVMEELFQTPLYRNLLPRVGSQGQPLQELMLGYSDSNKDSGFLSSNWEIHKA
QIALQDLAARNGVALRLFHGRGGSVGRGGGPAYQAILAQPSGTLQGRIKITEQGEVLASK
YSLPELALYNLETVSTAVVQNSLVTNQLDATPSWNDLMARLARCSRRHYRALVHDNPDLV
AFFEQVTPIEEISKLQISSRPARRKTGTRDLSSLRAIPWVFGWTQSRFLLPSWFGVGTAL
HEELVNDPDQMSLLRTLHQRWPFFRMLISKVEMTLSKVDLDLARHYVTSLGSADHRQAFD
GIYTTIAEEYSLTHRLVLEITGQERLLDADPALQLSVDLRNRTIVPLGFLQVALLRRLRD
QNRQPPMSESPSDGDGRTYSRSELLRGALLTINGIAAGMRNTG
NT seq 3012 nt NT seq  +upstreamnt  +downstreamnt
atgatcatgacggtttctgatcccggcgggtcttcgatgtcctcctcctccgcaatcact
cctgagagcgagcaggccatggccgcggtcaacgacgcccctgtcggtggacaactcctg
cagcaacgactggccctggtcgaggacctctggcagaccgttctgcgcagtgagtgccca
gccgagcaggcggagcgcttgctgcgcatgaaacaactcagcgacccggtccttcccgag
ggaaacgccgtgagcagtgatgctttggtgtcgctgatcagggacatggacctgtcggaa
gcgatcgctgccgctcgggccttttccctctatttccaactggtgaacatcctcgagcag
cgcatcgaggaagacgggtatctggagagcatcgtccgttcccaggacacagcggaacag
atcaacccgttcacccctcccctggccacccagacagaacccgcaacctttcgggaactg
tttgaacgtctgcgccgactgaacgtcccccctgcccagctggagacgctgctccaggag
ctcgatatccgcctggtcttcaccgctcaccccaccgagatcgtccgtcacaccgtccgc
cacaaacagcgccgcgtggcaagccttctgcagcagctcgaagcccagactgaatccagc
acctttgaagcgggaacgatccgccttcaattggaggaggaaatcaggctgtggtggcgc
actgatgagctgcaccagttcaagccctcggtgttggatgaggtcgattacgccctgcac
tacttccagcaggtgctgttcgatgccatgccccagctgcgtcgccgcctctcctcggca
ctggccagcagctacccggatgtgcaactgccgccgtcgtccttttgcaccttcggatcc
tgggttggatccgatcgcgatggcaatccatcggtcacgaccgacatcacctggcgaaca
gcctgttatcagcgccagctgatgctggagcgttacgtgagcgcggttcaggggcttcgc
gaccagctgagcatttccatgcaatggagccaagtcagcgccccacttcttgaatccctg
gaaatggatcggttgagattcccggaggtgtacgaagagcgggccacccgctaccgcctt
gagccttaccgtctcaagctgagttttgtgcttgagcggctgcgcctcacgcagatccgc
aaccagcagcttgcggaagccggttggcgtgctccagcggatggactgctgagctccaac
cccgaggcaccgcagagtgaatcgcttcactacggatctgtggccgagttccgcagtgac
cttgaactgattcgcacgagtttggtcagtacagacctcacctgcgaacccctcgacacg
ctgctcacccaggtgcacattttcgggttcagccttgccggtctggacattcgccaggag
agcacccgccacagcgatgctctcgatgaagtgagtcgctatctcaaccccgaccaggcc
tacggggatctgaacgaacaggaacgcgtgcagtggctgcttcaggagctgcagacccgc
cgccccctgatcccaccctcggtgagctggtcaccaacaacggaagaaaccgttgatgtg
ttccgaaccctgcatcgcctgcaggacgaattcggcagtcgaatttgccgaacgtatgtg
atctccatgagccacagcgtttcggatctgctcgaggtgctgctcctttccaaggaggca
gggcttgtggaaccgtctgcaggccatgccgacctgctggtggttccgctcttcgaaacc
gtggaggatctccagagagccccagaggtgatggaagagttgttccagacaccgctttat
cgcaaccttcttcccagggttggcagccagggccaacccttgcaggagctgatgctcggg
tattccgatagcaacaaggattcgggctttctctccagcaactgggagattcacaaagca
cagattgcccttcaggaccttgcagcgaggaacggcgtggccctgcggctgttccacgga
cgtggtggttcagtgggccggggagggggacctgcctaccaggcgatcctggcgcaaccc
agcggcacgctccagggacgcatcaaaatcacggagcaaggggaagttctcgcctccaag
tacagcctgcctgaactcgctctctacaacctcgaaacagtgagcaccgccgttgtgcag
aacagcctggtcaccaaccaactggatgccactcccagctggaacgatctaatggcgcga
ctggcgcgttgctcaagacgccactaccgcgcgttggtgcacgacaaccccgatctggtc
gccttcttcgagcaggtgacgccaatcgaggagatcagcaagctgcagatctccagccgg
cccgcccggcgtaagaccggaacgcgggatctctccagcctgcgggccattccctgggtg
tttggctggacccagagccgctttctcctccccagctggtttggcgtcggaacagctctg
catgaagagcttgtgaacgaccccgatcagatgtcgttgctgaggaccctccaccagcgc
tggcctttcttcaggatgctgatttccaaagtggagatgaccctctccaaggtggatctc
gatctggcccgtcactacgtgaccagcctggggagtgccgatcatcgtcaagcgttcgac
ggcatctacacgaccatcgccgaggaatacagcctcacccaccggctggtactggagatc
acagggcaagaacgactgctggatgccgatccagccctccagctctccgtggatctgcgc
aaccgcaccatcgtgcccttgggatttctgcaggtcgccctgctgcgccgattacgggac
cagaatcgtcaaccgcccatgagcgaatctcccagcgacggcgacggccgcacgtacagc
cgaagcgaacttctgcgtggtgcccttctcacgatcaatggcattgccgcaggcatgcgc
aacaccgggtga

DBGET integrated database retrieval system