KEGG   Synechococcus sp. WH7803: SynWH7803_0582Help
Entry
SynWH7803_0582    CDS       T00524                                 

Gene name
pdhC
Definition
(GenBank) Dihydrolipoyllysine-residue acetyltransferase component of pyruvate dehydrogenase complex
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
syx  Synechococcus sp. WH7803
Pathway
syx00010  Glycolysis / Gluconeogenesis
syx00020  Citrate cycle (TCA cycle)
syx00620  Pyruvate metabolism
syx01100  Metabolic pathways
syx01110  Biosynthesis of secondary metabolites
syx01120  Microbial metabolism in diverse environments
syx01130  Biosynthesis of antibiotics
syx01200  Carbon metabolism
Module
syx_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:syx00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SynWH7803_0582 (pdhC)
   00020 Citrate cycle (TCA cycle)
    SynWH7803_0582 (pdhC)
   00620 Pyruvate metabolism
    SynWH7803_0582 (pdhC)
Enzymes [BR:syx01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     SynWH7803_0582 (pdhC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding
Motif
Other DBs
NCBI-ProteinID: CAK23008
CyanoBase: SynWH7803_0582
CYORF: SynWH7803_0582
UniProt: A5GJ93
LinkDB All DBs
Position
586023..587372
Genome map
AA seq 449 aa AA seqDB search
MATHDIFMPALSSTMTEGKIVEWLKKPGDKVARGESVLVVESDKADMDVESFNDGFLASV
LMPAGSTAPVGETIGLIVESEAEIAEAQAKAPSGGAAAPASAPAAAAAPPAAPSAPTPVP
SAPVSSPPPATAPPAPAAVPAPAPTGTGRLIVSPRAKKLAAQMGVDLSSLRGSGPNGRIQ
AEDVERAAGRPVSVPQVGEGTAPAALAGGAVPAPPSAPAGNSFGRPGETVPFNTLQAAVN
RNMEASLAVPSFRVGYTITTDKLDAFYKQVKPKGVTMTALLAKAVAVTLARHPQVNAATT
QAGMAYPADVNVAVAVAMEDGGLITPVLRQADRIDLYELSRQWGDLVKRSRSKQLQPEEY
STGTFTLSNLGMFGVDRFDAILPPGTGAILAVAASRPTVVAAKDGSIAVKRQMQVNLTAD
HRVIYGADGAAFLKDLAELIEMRPESLAL
NT seq 1350 nt NT seq  +upstreamnt  +downstreamnt
ttggcgacccacgacatcttcatgcctgccctcagctccaccatgacggagggcaagatc
gtggagtggctcaaaaagcctggtgacaaggttgcccggggtgagtccgtcctcgtcgtt
gagtcggacaaggccgacatggacgtggagtcgttcaacgacggcttcctggcgtctgtg
ctgatgcctgcgggcagcacggcaccggtgggagaaaccatcgggctgatcgttgaatca
gaagcggagatcgcggaggcacaggccaaggctccgtccggtggtgcagcggctccagcc
agcgcaccagcggcagcggcagcaccaccggcagcaccatcggcgcccacaccggttccc
tcggctccggtctcttccccgccgcctgcaacggctccaccggcccctgctgctgtgccc
gctcctgcgccaacgggtaccgggcgcttgatcgtcagtccgcgtgccaagaaactcgcc
gcccagatgggtgtggatctctcgtcgctgcgcggcagtggtccgaacggacgcatccag
gcggaggatgtggagcgtgccgctggtcggcctgtgtccgttccccaggtgggtgaaggc
actgcacccgctgcgcttgcgggtggcgccgtgccggctccgccgagtgctcccgctggc
aacagcttcgggcgccccggtgagacggtgccgttcaacacccttcaagcggcggtgaac
cgcaacatggaggccagcctggctgtgcccagcttccgtgtggggtacaccatcaccacc
gacaagctcgatgccttctacaaacaggtcaagcccaagggcgtgaccatgacggccctt
ctggccaaggcggtggccgtcacgctggcgcgtcatccccaggtgaacgccgcaaccacc
caggcaggaatggcctaccccgcggatgtgaatgtggcggtggccgtggccatggaagac
ggtgggttgatcacgcccgtgctgcgtcaggccgatcgcatcgacctttatgaactctcc
cgccagtggggtgatctggtgaaacgctcccgcagcaagcagctgcagccggaggaatac
agcaccggcacgttcaccctctccaacctcgggatgtttggtgtggatcgctttgatgcg
atcctccctccgggcaccggtgccatcctggctgtcgcggcttctcggccaacggtggtg
gccgcaaaagacggctcaattgcggtgaagcgccagatgcaagtgaatctcacggcggat
caccgggtgatctacggagcggatggagccgccttcctcaaggatctggccgagctgatc
gagatgcgtcctgaaagcctggctctctga

DBGET integrated database retrieval system