KEGG   Synechococcus sp. WH7803: SynWH7803_0582
Entry
SynWH7803_0582    CDS       T00524                                 

Gene name
pdhC
Definition
(GenBank) Dihydrolipoyllysine-residue acetyltransferase component of pyruvate dehydrogenase complex
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
syx  Synechococcus sp. WH7803
Pathway
syx00010  Glycolysis / Gluconeogenesis
syx00020  Citrate cycle (TCA cycle)
syx00620  Pyruvate metabolism
syx01100  Metabolic pathways
syx01110  Biosynthesis of secondary metabolites
syx01120  Microbial metabolism in diverse environments
syx01200  Carbon metabolism
Module
syx_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:syx00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SynWH7803_0582 (pdhC)
   00020 Citrate cycle (TCA cycle)
    SynWH7803_0582 (pdhC)
   00620 Pyruvate metabolism
    SynWH7803_0582 (pdhC)
Enzymes [BR:syx01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     SynWH7803_0582 (pdhC)
SSDB
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding
Other DBs
NCBI-ProteinID: CAK23008
CyanoBase: SynWH7803_0582
CYORF: SynWH7803_0582
UniProt: A5GJ93
LinkDB
Position
586023..587372
AA seq 449 aa
MATHDIFMPALSSTMTEGKIVEWLKKPGDKVARGESVLVVESDKADMDVESFNDGFLASV
LMPAGSTAPVGETIGLIVESEAEIAEAQAKAPSGGAAAPASAPAAAAAPPAAPSAPTPVP
SAPVSSPPPATAPPAPAAVPAPAPTGTGRLIVSPRAKKLAAQMGVDLSSLRGSGPNGRIQ
AEDVERAAGRPVSVPQVGEGTAPAALAGGAVPAPPSAPAGNSFGRPGETVPFNTLQAAVN
RNMEASLAVPSFRVGYTITTDKLDAFYKQVKPKGVTMTALLAKAVAVTLARHPQVNAATT
QAGMAYPADVNVAVAVAMEDGGLITPVLRQADRIDLYELSRQWGDLVKRSRSKQLQPEEY
STGTFTLSNLGMFGVDRFDAILPPGTGAILAVAASRPTVVAAKDGSIAVKRQMQVNLTAD
HRVIYGADGAAFLKDLAELIEMRPESLAL
NT seq 1350 nt   +upstreamnt  +downstreamnt
ttggcgacccacgacatcttcatgcctgccctcagctccaccatgacggagggcaagatc
gtggagtggctcaaaaagcctggtgacaaggttgcccggggtgagtccgtcctcgtcgtt
gagtcggacaaggccgacatggacgtggagtcgttcaacgacggcttcctggcgtctgtg
ctgatgcctgcgggcagcacggcaccggtgggagaaaccatcgggctgatcgttgaatca
gaagcggagatcgcggaggcacaggccaaggctccgtccggtggtgcagcggctccagcc
agcgcaccagcggcagcggcagcaccaccggcagcaccatcggcgcccacaccggttccc
tcggctccggtctcttccccgccgcctgcaacggctccaccggcccctgctgctgtgccc
gctcctgcgccaacgggtaccgggcgcttgatcgtcagtccgcgtgccaagaaactcgcc
gcccagatgggtgtggatctctcgtcgctgcgcggcagtggtccgaacggacgcatccag
gcggaggatgtggagcgtgccgctggtcggcctgtgtccgttccccaggtgggtgaaggc
actgcacccgctgcgcttgcgggtggcgccgtgccggctccgccgagtgctcccgctggc
aacagcttcgggcgccccggtgagacggtgccgttcaacacccttcaagcggcggtgaac
cgcaacatggaggccagcctggctgtgcccagcttccgtgtggggtacaccatcaccacc
gacaagctcgatgccttctacaaacaggtcaagcccaagggcgtgaccatgacggccctt
ctggccaaggcggtggccgtcacgctggcgcgtcatccccaggtgaacgccgcaaccacc
caggcaggaatggcctaccccgcggatgtgaatgtggcggtggccgtggccatggaagac
ggtgggttgatcacgcccgtgctgcgtcaggccgatcgcatcgacctttatgaactctcc
cgccagtggggtgatctggtgaaacgctcccgcagcaagcagctgcagccggaggaatac
agcaccggcacgttcaccctctccaacctcgggatgtttggtgtggatcgctttgatgcg
atcctccctccgggcaccggtgccatcctggctgtcgcggcttctcggccaacggtggtg
gccgcaaaagacggctcaattgcggtgaagcgccagatgcaagtgaatctcacggcggat
caccgggtgatctacggagcggatggagccgccttcctcaaggatctggccgagctgatc
gagatgcgtcctgaaagcctggctctctga

DBGET integrated database retrieval system