KEGG   Synechococcus sp. WH7803: SynWH7803_0678Help
Entry
SynWH7803_0678    CDS       T00524                                 

Gene name
rbcL, cbbL
Definition
(GenBank) Ribulose bisphosphate carboxylase large subunit
  KO
K01601  ribulose-bisphosphate carboxylase large chain [EC:4.1.1.39]
Organism
syx  Synechococcus sp. WH7803
Pathway
syx00630  Glyoxylate and dicarboxylate metabolism
syx00710  Carbon fixation in photosynthetic organisms
syx01100  Metabolic pathways
syx01120  Microbial metabolism in diverse environments
syx01200  Carbon metabolism
Module
syx_M00165  Reductive pentose phosphate cycle (Calvin cycle)
syx_M00166  Reductive pentose phosphate cycle, ribulose-5P => glyceraldehyde-3P
syx_M00611  Oxygenic photosynthesis in plants and cyanobacteria
Brite
KEGG Orthology (KO) [BR:syx00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    SynWH7803_0678 (rbcL)
  09102 Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    SynWH7803_0678 (rbcL)
Enzymes [BR:syx01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.39  ribulose-bisphosphate carboxylase
     SynWH7803_0678 (rbcL)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RuBisCO_large RuBisCO_large_N
Motif
Other DBs
NCBI-ProteinID: CAK23104
CyanoBase: SynWH7803_0678
CYORF: SynWH7803_0678
UniProt: P96486
LinkDB All DBs
Position
674560..675975
Genome map
AA seq 471 aa AA seqDB search
MSKKYDAGVKEYRDTYWTPDYVPLDTDLLACFKCTGQEGVPKEEVAAAVAAESSTGTWST
VWSELLTDLDFYKGRCYRIEDVPGDKESFYAFIAYPLDLFEEGSITNVLTSLVGNVFGFK
ALRHLRLEDIRFPMAFIKSCYGPPNGIQVERDRMNKYGRPLLGCTIKPKLGLSGKNYGRV
VYECLRGGLDFTKDDENINSQPFQRWQNRFEFVAEAIKLSEQETGERKGHYLNVTANTPE
EMYERAEFAKELGMPIIMHDFITGGFTANTGLSKWCRKNGMLLHIHRAMHAVIDRHPKHG
IHFRVLAKCLRLSGGDQLHTGTVVGKLEGDRQTTLGYIDQLRESFVPEDRSRGNFFDQDW
GSMPGVFAVASGGIHVWHMPALVTIFGDDSVLQFGGGTHGHPWGSAAGAAANRVALEACV
KARNAGRHLEKESRDILMEAGKHSPELAIALETWKEIKFEFDTVDKLDVQN
NT seq 1416 nt NT seq  +upstreamnt  +downstreamnt
atgagcaagaagtacgacgccggggtcaaggagtacagagacacttactggactcccgat
tacgttcccctcgacaccgacctgctggcctgcttcaagtgcaccggccaggaaggtgtg
cccaaggaagaagttgccgctgctgtggctgctgaatcctcaaccggcacctggtccact
gtgtggtccgagctcctcaccgacctcgacttctacaagggccgctgctaccgcatcgaa
gacgtccctggtgacaaggagtcgttctatgccttcatcgcttaccccctcgacctgttc
gaagagggttccatcaccaacgttctgacctccctggtcggcaacgtgttcggtttcaag
gccctgcgtcacctccgtctggaagacatccgcttcccgatggcgttcatcaagagctgc
tacggcccgccgaacggcatccaggtcgagcgcgaccggatgaacaagtacggccgtccc
ctgctgggttgcaccatcaagccgaagctcggcctgagcggcaagaactacggccgtgtg
gtctatgagtgcctgcgtggcggtctggacttcaccaaggacgacgagaacatcaactcc
cagcccttccagcgttggcagaaccgcttcgaattcgttgcggaagccatcaagctgtcc
gagcaggagaccggtgagcgcaagggtcactacctcaacgtgaccgccaacactcccgaa
gagatgtatgagcgcgctgagttcgccaaggaactcggcatgccgatcatcatgcacgac
ttcatcaccggtggcttcacggccaacaccggtctgtcgaagtggtgccgcaagaacggc
atgttgctgcacatccaccgcgccatgcacgcggtgatcgaccgtcaccccaagcacggc
atccacttccgcgttctcgcgaagtgtctgcgtctgtccggtggtgaccagctccacacc
ggcaccgtggtcggaaagctggaaggtgatcgtcagaccaccctcggctatatcgaccag
ctgcgcgaatccttcgtgcccgaagaccgcagccgcggcaacttcttcgatcaggactgg
ggttccatgcctggcgtgttcgccgttgcttccggcggtatccacgtctggcacatgccc
gccctggtcaccatcttcggcgacgactccgttctgcagttcggtggtggtacccacggt
cacccctggggttccgctgcaggtgctgcggccaaccgcgtggccctcgaggcctgcgtc
aaggcccgcaacgccggccgtcatctcgagaaagagagccgcgacatccttatggaagcc
ggcaagcacagccccgagctggctatcgccctcgagacctggaaggagatcaagttcgag
ttcgacaccgtcgacaagctcgacgttcagaactga

DBGET integrated database retrieval system