KEGG   Synechococcus sp. WH7803: SynWH7803_0820Help
Entry
SynWH7803_0820    CDS       T00524                                 

Definition
(GenBank) Glutathione S-transferase domain protein
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
syx  Synechococcus sp. WH7803
Pathway
syx00480  Glutathione metabolism
Brite
KEGG Orthology (KO) [BR:syx00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    SynWH7803_0820
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:syx02000]
    SynWH7803_0820
Enzymes [BR:syx01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     SynWH7803_0820
Transporters [BR:syx02000]
 Other Transporters
  Pores ion channels [TC:1]
   SynWH7803_0820
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GST_N_3 GST_N_2 GST_C_2 GST_N_4 GST_N Glutaredoxin GST_C GST_C_5
Motif
Other DBs
NCBI-ProteinID: CAK23246
CyanoBase: SynWH7803_0820
CYORF: SynWH7803_0820
UniProt: A5GJY1
LinkDB All DBs
Position
798527..799777
Genome map
AA seq 416 aa AA seqDB search
MTDDSLKAEALSWAALEALAPAAAERVEGPTNAQASLRLFGHSEADVQVTLFRDHHAWCP
YCQKVWLWLELRRVPYRIRKVTMRCYGPKEPWFTALVPSGMLPALELNGRLITESDRILE
ALERTFGPVGAGMHDRRVRRLRELERLLFRAWCVWLCTPGLREDQERRARDQFQRVASQM
EEAIAAGGGCWLDPDHPSGATPGTADLVFIPYVERMNASLAYFKGFALREAHPGIDRWLT
ALEQLETYRGTQSDVHTHAHDLPPQMGGCWADGSAQQQFMAAAVDQGEGLGALECRWTPP
EAGVTPQARALERVLRHRHTLLVRSPLGEGFDQPLRAALTKLIAGTAVMPSSGSAAALRY
LRDRISVPRDMPLHSARLLRQALESTAALAGQDQPSALPFEHRFDQDPRPFVGSVT
NT seq 1251 nt NT seq  +upstreamnt  +downstreamnt
atgacagacgattcgctgaaggcggaggcgctctcctgggctgctctggaggctttggca
ccggctgctgccgaacgcgtggaaggccccaccaacgcccaggccagcttgcggctgttc
gggcattccgaagcagatgtgcaggtgaccttgttccgggaccaccacgcctggtgcccg
tactgccagaaggtgtggctctggcttgagctgcgccgggtgccctatcggatccgcaag
gtcaccatgcgctgctatggcccgaaggagccctggttcacggcactggttccctcggga
atgttgccggctctggaactcaatggtcgcctgatcacggagagcgatcgcatcctcgag
gcccttgaacgcactttcgggccggtgggagctggcatgcatgaccggcgggtgaggcgt
ttgcgtgagctggaacggttgctgttccgcgcctggtgtgtgtggctctgcaccccaggc
ctgcgcgaggaccaggaacgccgtgcccgggatcagttccagagggtggcctcccagatg
gaggaggcgatcgccgctggtggtggctgctggctcgatcccgaccatccgagcggggca
acacctggcaccgccgatctggtgttcatcccctacgtggagcgcatgaatgcgtcgctc
gcctacttcaaggggtttgcactgcgtgaggcccaccccgggatcgaccgttggctcacg
gcccttgagcaactcgagacgtatcgcggcacccagagtgatgtgcacacccatgcccac
gatctgcctccgcagatgggcggatgctgggcggatggcagtgcgcagcaacaattcatg
gccgcggcggtggatcaaggggagggactgggtgccctcgaatgccgttggacaccgcct
gaagcaggggtcactccccaggcccgagccctggagcgggtgctgcgccatcgccacacg
ctgctcgtgcgcagccctctcggggaggggtttgatcagcccttgcgcgcggcactcacc
aagctgatcgctgggaccgcagtgatgccgtcttcagggtcagccgcagctctgcgctat
ctgcgggatcgcatctctgtgccccgcgacatgcctctgcacagcgcccggctactaagg
caggccctcgaaagcaccgcggctcttgcaggccaggaccaaccatctgcgctgccattt
gagcatcgcttcgaccaggatcccaggccatttgtcggctcggtcacctga

DBGET integrated database retrieval system