KEGG   Synechocystis sp. PCC 6803 GT-S: SYNGTS_0917Help
Entry
SYNGTS_0917       CDS       T02098                                 

Gene name
nrtB
Definition
(GenBank) nitrate transport protein subunit NrtB
  KO
K15577  nitrate/nitrite transport system permease protein
Organism
syy  Synechocystis sp. PCC 6803 GT-S
Pathway
syy00910  Nitrogen metabolism
syy02010  ABC transporters
Module
syy_M00438  Nitrate/nitrite transport system
syy_M00615  Nitrate assimilation
Brite
KEGG Orthology (KO) [BR:syy00001]
 09100 Metabolism
  09102 Energy metabolism
   00910 Nitrogen metabolism
    SYNGTS_0917 (nrtB)
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    SYNGTS_0917 (nrtB)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:syy02000]
    SYNGTS_0917 (nrtB)
Transporters [BR:syy02000]
 ABC Transporters, Prokaryotic Type
  Mineral and organic ion transporters
   Nitrate/nitrite transporter [MD:M00438] [OT]
    SYNGTS_0917 (nrtB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: BPD_transp_1
Motif
Other DBs
NCBI-ProteinID: BAK49665
LinkDB All DBs
Position
complement(1008321..1009148)
Genome map
AA seq 275 aa AA seqDB search
MASSTAGLRPRRKKNPLSFIYSPKVIRPAVAIAVLLVVWQILCSGEGSNLPSPVQVLEQT
YPLILNPFFDNGGTDKGLGIQIFASLTRVAVGFSAAAVVGIALGILIGSSKFMYDALDPI
FQVLRTIPPLAWLPIALAALQEAEPSAIFVIFITAIWPIVINTTVGAQQVPQDYRNVSRV
LKLSKSQYFFNILFPAAVPYIFTGLRIGIGLSWLAIVAAEMLIGGVGIGFFIWDAYNSSL
ISEIIIALIYVGIVGLLLDRFIAFLESLVVPAEQK
NT seq 828 nt NT seq  +upstreamnt  +downstreamnt
atggctagttccaccgctgggctccgtccccgccgcaagaaaaatcccctcagtttcatt
tacagtcccaaggttattcgtcccgccgtggcgatcgccgttttgttggtggtttggcag
attctctgctccggagaaggttctaatctgcccagtcccgtgcaggtcttagaacaaacc
tatcctttaattctcaatcccttttttgacaatggtggcacagacaagggtttaggcatc
caaatttttgccagtttaaccagggtggcagtgggcttcagtgcggcggcggtggtgggc
attgccctaggcatcttaattggtagtagcaaatttatgtatgatgccctcgatccaatt
tttcaggttctaagaaccattcctcccttggcctggttgcccattgctctggcggctttg
caggaagcagagccttcggccattttcgttattttcattacggcaatttggcccatcgtc
atcaacaccacggtgggagctcaacaggttccccaggattatcggaatgtttcccgggtt
ctaaaactctccaaaagccaatactttttcaatattctattcccggcagcagtgccctac
attttcactggcctacgcattggcattggtctttcctggttggcgatcgtggcagcggaa
atgctgattggtggtgtgggcattggcttttttatctgggatgcctataacagctccctg
atcagtgaaatcattattgccttaatttatgtgggcattgtcggtttattgctagatcgt
tttatcgcttttctggaaagtttagtggtcccagcggagcaaaagtga

DBGET integrated database retrieval system