KEGG   Synechocystis sp. PCC 6803 GT-S: SYNGTS_1264Help
Entry
SYNGTS_1264       CDS       T02098                                 

Gene name
pstB
Definition
(GenBank) phosphate transport ATP-binding protein PstB
  KO
K02036  phosphate transport system ATP-binding protein [EC:7.3.2.1]
Organism
syy  Synechocystis sp. PCC 6803 GT-S
Pathway
syy02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:syy00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    SYNGTS_1264 (pstB)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:syy02000]
    SYNGTS_1264 (pstB)
Enzymes [BR:syy01000]
 7. Translocases
  7.3  Catalysing the translocation of inorganic anions and their chelates
   7.3.2  Linked to the hydrolysis of a nucleoside triphosphate
    7.3.2.1  ABC-type phosphate transporter
     SYNGTS_1264 (pstB)
Transporters [BR:syy02000]
 ABC transporters, prokaryotic type
  Phosphate and amino acid transporters
   Phosphate transporter
    SYNGTS_1264 (pstB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ABC_tran AAA_21 SMC_N AAA_29 ABC_ATPase AAA_15 RsgA_GTPase AAA_22 AAA_16 G-alpha AAA_23 AAA_30 Rad17 PRK AAA AAA_33 AAA_28 AAA_24 NB-ARC RNA_helicase MMR_HSR1 NACHT AAA_25
Motif
Other DBs
NCBI-ProteinID: BAK50012
LinkDB All DBs
Position
1390793..1391608
Genome map
AA seq 271 aa AA seqDB search
MTNLSGSMPSSTAADLQPALRVEGLGFYYGTKKVLEGVTMAIPVGKVTAMIGPSGCGKST
LLKAFNRIAELEGRVKVTGKIEFFGQNIYDQKVNINSLRREIGMVFQRPNPFPTSIYDNI
VYGVKLCCNVSRAELDEIVERSLTRAVLWDEVKDSLKKSALGLSGGQQQRLCIARALAVN
PKVLLMDEPCSALDPISTLKIEELINSLRENVTITIVTHNMQQALRVSDYTAFFNTDESR
IGQLVEFDTTQNIFSSPQETQTRDYVAGRFG
NT seq 816 nt NT seq  +upstreamnt  +downstreamnt
atgactaatttgtccggttcaatgcccagctccacagcagcggatttacagcctgccctc
agggttgaaggtttgggattttattacggcaccaaaaaagtgttagagggggtaaccatg
gcaatccccgttggtaaggtcactgccatgattggcccttctggttgtggtaaatcaact
ttgctcaaagcttttaaccgcattgccgaactggagggacgggtgaaagtaaccgggaaa
atcgaatttttcggacaaaatatttacgatcaaaaggtcaatattaatagcctgcgtcgg
gaaattggcatggtctttcagcgccccaatcctttccccaccagcatttacgacaacatt
gtctatggggttaaactttgttgcaatgtgagccgggccgaattggatgaaattgtcgaa
cgttccctcactagggcagtgttgtgggatgaagtcaaggatagtttgaaaaaatctgct
ttgggtttatcggggggacaacagcaacgcctatgtattgccagggcgttagcggtcaat
cccaaggtgttgttaatggatgaaccctgttctgctctcgatcctatttctactctgaaa
attgaggaattaatcaatagtctgcgggaaaatgtgaccatcaccattgtgacccacaat
atgcaacaggccctgagggtgtctgactacacagcgtttttcaataccgatgaaagccgt
atcggtcagttagtagaattcgacaccacccagaatattttctctagtccccaggaaacc
caaaccagggattatgtggctggtcgctttggctag

DBGET integrated database retrieval system