KEGG   Synechocystis sp. PCC 6803 GT-S: SYNGTS_1734Help
Entry
SYNGTS_1734       CDS       T02098                                 

Gene name
pet112
Definition
(GenBank) glutamyl-tRNA(Gln) amidotransferase subunit B
  KO
K02434  aspartyl-tRNA(Asn)/glutamyl-tRNA(Gln) amidotransferase subunit B [EC:6.3.5.6 6.3.5.7]
Organism
syy  Synechocystis sp. PCC 6803 GT-S
Pathway
syy00970  Aminoacyl-tRNA biosynthesis
syy01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:syy00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    SYNGTS_1734 (pet112)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:syy03029]
    SYNGTS_1734 (pet112)
Enzymes [BR:syy01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.6  asparaginyl-tRNA synthase (glutamine-hydrolysing)
     SYNGTS_1734 (pet112)
    6.3.5.7  glutaminyl-tRNA synthase (glutamine-hydrolysing)
     SYNGTS_1734 (pet112)
Mitochondrial biogenesis [BR:syy03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    SYNGTS_1734 (pet112)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GatB_N GatB_Yqey
Motif
Other DBs
NCBI-ProteinID: BAK50482
LinkDB All DBs
Position
complement(1901254..1902741)
Genome map
AA seq 495 aa AA seqDB search
MTATAVKTDYEAIIGLETHCQLNTASKIFCNCSTDFDSPPNTNVCPVCLGYPGVLPVLNE
EVLAAAVKLGLAINGQIAPYSKFDRKQYFYPDLPKNYQISQFDLPIVEHGSLEIELVDKK
TKEITRKTIGITRLHMEEDAGKLVHAGSDRLAGSTHSLVDFNRTGVPLLEIVSEPDLRTG
QEAAEYAQSLRQLVRYLGISDGNMQEGSLRCDVNISVRPVGQKEFGTKVEIKNMNSFSAI
QKAIEYEIERQIKAIADGEEIYQETRLWEEGSQRTISMRKKEGSSDYRYFPEPDLPPLEV
SEQQKQTWFATLPELPSAKRARYEQKLGLSAYDARVLTEDRDVALYFEEAVNAGADPKAV
ANWVTQDIAAYLNNNRLTISGLALKPSALAELIDLITKGTISGKIAKDILPELLEKGGSP
QKIIEARGLVQISDPDELTAIIQAVIADHPKELEKFRSGKGNMQGFFVGQVMKRTGGKAD
PKLTNQLIGKLLAQA
NT seq 1488 nt NT seq  +upstreamnt  +downstreamnt
atgactgccactgctgttaaaaccgattacgaagcgattattgggctagaaacccactgt
cagctcaacacagctagtaagattttttgtaattgctccactgattttgacagtcccccc
aacaccaatgtctgtccggtgtgtttgggttatccgggggttctgccagtgctcaatgaa
gaagtgttggcggcggcggttaaacttggcttagccatcaatggccagattgccccctac
agtaagtttgaccgcaagcagtatttttatccggatttacctaagaactatcaaatttcc
cagtttgatttgcccattgtggagcatggctccttggaaattgagttggtggataaaaaa
actaaagagattacccgcaaaaccattggcatcactcgtttacatatggaggaagatgcg
ggcaaattagtccatgcggggagcgatcgcctggcggggtcaacccattccctggtggat
ttcaatcgcactggggtacctttactagaaattgtttcggagccggatttacgcacgggg
caggaagcggcggagtatgcccagtctttacgccaactggtgcgttacctaggcattagc
gacggcaatatgcaagaaggttccctccgttgtgatgtaaatatttctgtgcgtccggtg
gggcaaaaggaatttggcaccaaggtggagatcaaaaacatgaactcctttagcgccatc
caaaaggcgatcgagtatgagattgaaaggcaaattaaggccatcgccgacggggaggag
atttaccaagaaacccgcctctgggaggaaggcagtcagcgcaccatcagcatgcgaaaa
aaggaaggctccagcgattatcgctattttcctgaaccggacttgccccccttagaagtg
tccgagcaacagaaacaaacttggtttgcaaccttgccggaactccccagtgccaaacgg
gcccgctatgaacagaaactgggtttatctgcctatgatgcccgggtattgaccgaagac
cgggatgtggcgctctattttgaggaagcggtgaatgccggagctgacccgaaagcagtg
gccaattgggttacccaggacattgccgcctacctcaacaacaaccgtttgaccatcagc
gggctggccctgaaaccgtcggccctggcggagttaattgatctaattaccaaaggcacc
attagcggcaaaattgccaaagatattctgccggagttgctggaaaaaggtggctctccc
cagaaaattattgaagctaggggcttggtgcaaatttctgaccccgacgagttgactgcc
atcatccaagctgtcattgctgaccatcccaaggagttggaaaaattccgcagtggtaag
ggcaatatgcagggtttctttgtcggtcaagtcatgaaacgtactggcggcaaggcagat
ccaaagttgactaatcaattaattggtaaactcctggcccaagcttaa

DBGET integrated database retrieval system