KEGG   Synechocystis sp. PCC 6803 GT-S: SYNGTS_1981Help
Entry
SYNGTS_1981       CDS       T02098                                 

Gene name
slr0152
Definition
(GenBank) serine/threonine protein kinase
Organism
syy  Synechocystis sp. PCC 6803 GT-S
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pkinase Pkinase_Tyr APH Pox_ser-thr_kin Kdo
Motif
Other DBs
NCBI-ProteinID: BAK50729
LinkDB All DBs
Position
2180880..2182775
Genome map
AA seq 631 aa AA seqDB search
MESLPVLGVFFMVKTANVAVMPLFPRSQYRIIGQIGQGQFGRVYCAIHRTTGKMYALKDL
EHRVFPTNKFLRELSYLLTLRHPNIVACHGLEYHPGGRYLVMDYCEGGTLRDIIDGDGDL
CLAGKIDLLRQILLGLAQAHQHDIVHCDLKPENILLIPRAEGWQVKVSDFGIARLTAKTG
NPNFSKGYTGSPAYMAPERFYGKFSVASDIYAVGILLYELIVGDRPFSGFPKALQAAHLN
VRLTLPPEFPPLLAPIVQRALEKLPQRRFPNATAMASDLATVQKQILEQDPPRGNGYLYH
HLAPAPLAFTATVKHSTPLLFPISHLTGAGLWLYLGNGAELYLWEYGDGNVEHHPLPRWA
LGLPGTIANLEVNQDQISLLIQGGEPGEWQFYQWRETLLGALSLPKPRINLRAERLLANL
SPGGKTLAVVVGDRDSEKGHFQLWRTDHSLPVAAAVVIRWPDQLLTLDQNHGLLVQSQST
ASYCHTIFFLFNRRGSLFPAFRLSFLVFQLVVNRYSRNHLFGLADNAPYTGILIRLQPLK
VNRIALTIQPQFIEPFPWGYLLADRHGEVALLDYEGFLFGNFSLGETITAIAPMGRYLCL
FATWQGNGGTLRLLDLGPQVENIIRQRQEKR
NT seq 1896 nt NT seq  +upstreamnt  +downstreamnt
atggaatcactccccgtcctaggcgtattttttatggtaaagactgccaatgtggcggtt
atgccgctgtttccccgctcccaatatagaatcattggacagatcggacagggacagttc
gggcgggtttactgtgctattcaccggactacgggcaaaatgtatgccctgaaggattta
gaacatcgggtatttcccactaataaatttctgcgggaactgtcctatctgttgaccctg
cgccatcccaacattgtggcttgccatggtttggagtaccatcctgggggccgctatttg
gtgatggattactgtgaggggggaactctgcgggacattattgatggggacggagattta
tgtttggcgggaaaaatagatttattaagacaaatattgctgggtttggcccaagcccat
cagcatgacattgtccactgtgaccttaaaccggaaaatatcctgttaataccccgggca
gagggatggcaggtaaaagtatcagattttggcattgctcgcctaacagctaaaacgggc
aatcctaatttcagcaagggttacactggttctcccgcctatatggccccggaacggttc
tacggcaagttttctgtagcttccgacatttatgctgtgggtattttgctgtacgagctc
atcgtcggcgatcgcccgttttcaggatttcctaaagcgttgcaggcagcccatctcaat
gtccgcttaaccttaccgccggaatttcctcccttacttgcccccattgtccaacgggct
ttggagaaattaccccaaagacgatttcccaatgccacagccatggccagtgatttggcc
acggttcaaaaacaaatattggaacaggatccccccaggggtaacggctatctttaccat
cacttggctccagctccgctagcctttacggccacagtcaaacacagtactcccttgtta
tttcccattagtcacctaactggggcaggactttggttatacctaggcaatggggccgaa
ctgtacctatgggagtatggcgatggaaatgtggagcaccatcctttgccccgctgggcg
ttgggtttaccgggaaccatagctaatctggaagtaaatcaagaccaaattagcctctta
atccagggaggtgaaccaggagaatggcaattttaccagtggcgagaaaccctacttggc
gctctctctctccccaaacctcgcattaatttgcgggcagagcgtctgttggccaatcta
agccccggtggtaaaactttggcagtggtagtaggcgatcgggacagtgaaaaaggccat
tttcaattatggcgcactgaccacagcttacctgtggctgcagccgtagtaattcgatgg
ccggatcaactgctcaccctagaccaaaaccatggcctgttggtgcagtctcaatcaacg
gcaagttattgtcatactatttttttcctgtttaatcggcgggggtccctgtttccagcc
tttcgcctttcttttttggtatttcaattggtagttaatcgctactcccgcaaccatctg
tttggcttggccgataatgctccctacactggtattttgattcgtctgcaacccctgaaa
gtcaatcgcattgccctaactatccagccccaattcattgagccttttccctggggttat
ctactagccgatcgccatggggaagtagctttgttggactatgaaggttttttatttggc
aatttttccctcggggaaaccatcacggcgatcgcccccatgggtcgctatctctgttta
tttgctacctggcagggcaatgggggaactttacgtcttctggatttgggtccccaagtg
gaaaacattattcgccaacgccaggaaaaacgctaa

DBGET integrated database retrieval system