KEGG   Synechocystis sp. PCC 6803: MYO_113280Help
Entry
MYO_113280        CDS       T02468                                 

Definition
(GenBank) hypothetical protein
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
syz  Synechocystis sp. PCC 6803
Pathway
syz00480  Glutathione metabolism
Brite
KEGG Orthology (KO) [BR:syz00001]
 Metabolism
  Metabolism of other amino acids
   00480 Glutathione metabolism
    MYO_113280
Enzymes [BR:syz01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     MYO_113280
Transporters [BR:syz02000]
 Other Transporters
  Pores ion channels [TC:1]
   MYO_113280
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GST_N_2 GST_N_3 GST_C_2 GST_C_5 Glutaredoxin GST_N GST_C GST_N_4 GST_C_3
Motif
Other DBs
NCBI-GeneID: 14616750
NCBI-ProteinID: AGF51580
LinkDB All DBs
Position
complement(1449788..1450987)
Genome map
AA seq 399 aa AA seqDB search
MITPLSWQALAELSDYQVDTVNGPTNAQATLRLFGQSKESLQVTLYRDNHAWCPYCQKVW
LWLEEKQIPYRIKKVTMFCYGEKEDWYKKLVPSGMLPALELDGRFYTESDDILIALEKAF
GPLLWAMEDPLVLPLRKLERLLFRAWCNWLCYPAMFPGADQRNQQQFQQVVNQVEKALEK
LPGPYFLPEFSTADIVFVPYVERMNASLFYYKGYSLREDNPRLKDWFAALETRMTYRGTQ
SDFHTHAHDLPPQMGGCYSNGSVQAQQNQQRVDNGPWFGLPDATCPEPENVKQEAIARVV
KHHENIIKVNAHNQGEKFDQALRCALTLLATGEKCAAPQGTDQALRYLRDRINVPRDMSI
YAAKHLRQALETTASLVGDSEGEPIPVRHRRDQDPANFR
NT seq 1200 nt NT seq  +upstreamnt  +downstreamnt
atgattactcccctttcttggcaagctttagctgaactatccgactatcaggtggatacg
gttaatggtcccaccaatgcccaggcaactctgagattatttggacaatcaaaggagtct
ttacaagttactctttatcgcgataaccatgcctggtgcccctattgtcaaaaagtttgg
ttatggttagaagaaaagcaaattccttaccgaatcaaaaaggtgaccatgttttgctat
ggggaaaaggaggattggtataaaaaattagtgccatcgggaatgttgcctgccttggaa
ctggatggtagattttacactgaaagcgatgatattttaatagccttagaaaaagctttt
ggaccattgctttgggcgatggaagatccattggtattaccccttagaaaactagaaagg
ttactgtttcgagcctggtgtaattggctctgctaccctgccatgtttcccggtgctgat
caacggaatcaacaacagtttcaacaggtggtgaatcaagtggaaaaagcattggaaaaa
ttacctggcccgtatttcttaccagaatttagcactgctgacatcgtttttgttccctac
gtggagcgcatgaatgcgagcttgttttattacaaaggttattccctaagggaggataat
ccccgcttaaaagactggtttgcggcgctggaaacccggatgacctataggggtacccag
agtgatttccatacccatgcccatgatttgccgccccaaatgggtggttgttactccaac
ggtagtgtccaggcccagcagaatcaacagcgggtggacaacggcccttggtttggttta
cccgatgccacctgcccggaaccggaaaatgttaagcaagaggcgatcgccagggtggtg
aaacaccacgaaaatattattaaggtcaatgcccataaccagggggaaaagtttgatcaa
gctctgcgctgtgcgttgaccctactggccacgggggaaaaatgtgcggcaccccagggt
acagaccaagcattgcgttatctgcgggatcggattaatgtgcccagggatatgtccatt
tatgcagctaaacatcttcgtcaagctttggaaaccaccgccagtttagtgggggacagc
gaaggagaacccattccagtgcgccaccgccgggatcaagacccagcaaattttcgctga

DBGET integrated database retrieval system