KEGG   Synechocystis sp. PCC 6803: MYO_118360Help
Entry
MYO_118360        CDS       T02468                                 

Gene name
ppc
Definition
(GenBank) phosphoenolpyruvate carboxylase
  KO
K01595  phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
syz  Synechocystis sp. PCC 6803
Pathway
syz00620  Pyruvate metabolism
syz00680  Methane metabolism
syz00710  Carbon fixation in photosynthetic organisms
syz01100  Metabolic pathways
syz01120  Microbial metabolism in diverse environments
syz01200  Carbon metabolism
Module
syz_M00168  CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:syz00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    MYO_118360 (ppc)
  09102 Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    MYO_118360 (ppc)
   00680 Methane metabolism
    MYO_118360 (ppc)
Enzymes [BR:syz01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     MYO_118360 (ppc)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPcase
Motif
Other DBs
NCBI-GeneID: 14617258
NCBI-ProteinID: AGF52081
LinkDB All DBs
Position
complement(1992616..1995720)
Genome map
AA seq 1034 aa AA seqDB search
MNLAVPAFGLSTNWSGNGNGSNSEEESVLYQRLKMVEELWERVLQSECGQELVDLLTELR
LQGTHEAITSEISEEVIMGITQRIEHLELNDAIRAARAFALYFQLINIVEQHYEQNEQQR
NRWEASQETNFYEQAGNEEEMVPPSRLGASTEPLPVGIDQNELQASVGTFHWLMRELKRL
NVPPQHIQNLLDHLDIRLVITAHPTEIVRHTIRRKQRRVDRILRKLDQLQGSVTGRDWLN
TWDAKTAIAQLTEEIRFWWRTDELHQFKPTVLDEVDYSLHYFDEVLFDAVPELSKRLGQA
IKETFPHLRAPRANFCYFGSWVGGDRDGNPSVTPEVTWQTACYQRGLVLGKYLFSLGELV
AILSPSLHWCKVSQELLDSLERDRIQLPEIYEELSLRYRQEPYRMKLAYVTKRLENTLRR
NNRLANPEERQTMITMPAENHYRTGEELLEELRLIQRNLTETGLTCLELENLITQLEVYG
FNLAQLDFRQESSRHAEAIAEIAEYMGVLTTPYEEMAEEDKLAWLGVELQTRRPLIPQEM
PFSERTRETIETLRTLRHLQMEFGVDICQTYIISMTNDASDVLEVLLLAKEAGLYDPATA
SNSLRIVPLFETVEDLKNAPGIMDSLFSLPFYRATLAGSYHSLKELQNQPPDYYQIPTTT
ALLNPGNLQEIMVGYSDSNKDSGFLSSNWEIHKAQKSLQAVAQSHRVILRLFHGRGGSVG
RGGGPAYKAILAQPAGTVDGRIKITEQGEVLASKYSLPELALYNLETLTTAVIQASLLKS
SFDFIEPWNRIMEELACTARRAYRSLIYEEPDFLDFFLTVTPIPEISELQISSRPARRKG
GKADLSSLRAIPWVFSWTQTRFLLPAWYGVGTALKSFVDQDPVKNMKLLRYFYFKWPFFN
MVISKVEMTLSKVDLTIASHYVQELSKPEDRERFDRLFQQIKQEYQLTRDFAMEITAHPH
LLDGDRSLQRSVLLRNRTIVPLGLLQISLLKRLRQVTQEAETSGVRYRRYSKEELLRGAL
LTINGIAAGMRNTG
NT seq 3105 nt NT seq  +upstreamnt  +downstreamnt
atgaacttggcagttcctgcattcggtctttccactaactggtctggtaatggcaatggt
tccaactctgaagaagagtcggtgctttaccagcggttaaagatggtggaggaattgtgg
gaaagggtgctccaaagcgaatgtggccaggaattggtggatttgctgacggaattaagg
cttcagggtacccatgaggcgatcaccagcgaaatttccgaagaagtcatcatgggtatt
acccagcgcattgagcatttagaactcaatgatgccatccgggcggctcgggcctttgcc
ctatatttccagttgatcaacatcgttgaacagcactacgaacaaaacgagcaacaacgg
aatcgttgggaagcttcccaggaaaccaacttctatgagcaggcgggcaatgaggaagaa
atggtccccccatcccgattaggcgcgtcaacggaaccattgccagtgggcattgaccag
aatgaattgcaagcttctgtaggtacgttccattggttaatgagggagctaaaacgcctc
aatgtgcccccccaacatatccaaaatttattggatcatctggacattcgcctggtgatc
accgctcaccccacggaaattgtccgtcacaccatccggcgcaaacaaagaagggtggac
cgcattcttcgtaaactagatcaactccagggttctgtgaccggtcgggactggctcaac
acctgggatgcaaaaacggcgatcgcccaattaacggaggaaattcgcttttggtggcgt
accgacgaacttcatcagttcaaacccactgtgttggacgaagtggactattccctccat
tattttgatgaagtactgttcgacgctgtaccggaattgtccaaacggttaggacaagct
attaaagaaacctttccccatctgcgggccccccgggctaatttttgttattttggctcc
tgggtcggtggcgatcgggacggcaacccttcggtaaccccagaagtgacctggcagacg
gcctgttaccagcggggtttagtgctggggaaatatttgtttagtttgggggaactggtg
gccattcttagcccttccctccattggtgcaaagtctcccaggaattgttggactctttg
gaacgggaccgcattcaattaccggaaatttacgaagaactttctctccgctatcgccag
gaaccctatcggatgaagctggcctacgttaccaaacggctggaaaacaccctgcggcgt
aataatcgtctagccaacccagaagaacggcaaacgatgatcaccatgccggccgaaaat
cactatcgcactggggaagaattattagaggaattaagactcattcagcgtaatctgacc
gaaactggtttaacctgcctggagttggaaaatttgattacccagttggaagtctatggc
tttaacctagcccagttggattttcgccaggaatcttcccgccacgccgaggcgatcgcc
gaaattgctgagtatatgggggtactcaccactccctacgaagaaatggccgaagaagat
aaattagcctggttaggggtagaactgcaaacccgccgtcctttaattccccaggaaatg
cccttttcggagcggactagggaaaccattgaaaccctccgcaccctgcgccatctacaa
atggaatttggggtggatatttgccaaacctacatcatcagcatgaccaacgatgccagt
gatgtgttggaagtattgctgttagccaaggaagccggattgtatgacccggccaccgcc
tccaattccctccgcattgtgcccctgtttgaaacagtagaagatctcaaaaacgctccg
gggattatggattctcttttcagcttgcctttttaccgggctacattggcgggcagttac
cattccttaaaagagttgcaaaatcagccaccggattattaccaaattcccaccaccaca
gccctactaaatcccggcaatctccaggaaattatggtgggctattccgacagcaataaa
gactccggctttttgagcagtaactgggaaattcataaggcccaaaaatcactgcaggca
gtggcccaaagccatcgggtaattctccggctgttccacggtcgaggaggatctgttggc
cgggggggcggcccggcctataaagccattttggcccagcccgcaggcaccgtggacggt
cggatcaaaattaccgaacaaggggaagtgttagcttctaaatattccctgccagagttg
gccctctacaacctggaaactttaaccacggcggtcatccaagctagtttacttaaaagt
agttttgatttcattgagccctggaaccggattatggaggagttggcctgcactgcccgt
cgagcctaccggagtttgatttacgaagaaccggactttttagatttcttcctgacggtt
acccccattcctgaaattagcgagttacagattagttcccgccctgcccgacgtaagggg
ggtaaagcggatctcagcagtttgcgggccattccctgggtgttcagttggacccaaacc
cgtttcctgctgccggcttggtatggggtgggcacggcgttgaaatcctttgtggaccaa
gacccggtcaaaaatatgaagttgttgcgttacttctatttcaaatggcctttcttcaac
atggtgatctcgaaggtggaaatgaccctttccaaggtggacctcaccatcgcttcccac
tatgtgcaagagctatctaagccagaagaccgggaacgattcgatcgcctttttcagcag
atcaagcaagagtatcaattaaccagggactttgccatggaaattacggcccatccccac
ctcctggacggcgatcgctctttgcaacggtcggtactcctacgaaatcgtactattgtt
cccctggggctactgcagatttccctgctgaaacgtttacgccaagtaacccaggaagcg
gagaccagcggcgtgcgttaccgtcgttattccaaagaagaactactgcggggagctctg
ttaaccattaacggtattgcggccggaatgcgtaatactggttga

DBGET integrated database retrieval system