KEGG   Synechocystis sp. PCC 6803: MYO_120620Help
Entry
MYO_120620        CDS       T02468                                 

Gene name
odhB
Definition
(GenBank) dihydrolipoamide acetyltransferase component (E2) of pyruvate dehydrogenase complex
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
syz  Synechocystis sp. PCC 6803
Pathway
syz00010  Glycolysis / Gluconeogenesis
syz00020  Citrate cycle (TCA cycle)
syz00620  Pyruvate metabolism
syz01100  Metabolic pathways
syz01110  Biosynthesis of secondary metabolites
syz01120  Microbial metabolism in diverse environments
syz01130  Biosynthesis of antibiotics
syz01200  Carbon metabolism
Module
syz_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:syz00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    MYO_120620 (odhB)
   00020 Citrate cycle (TCA cycle)
    MYO_120620 (odhB)
   00620 Pyruvate metabolism
    MYO_120620 (odhB)
Enzymes [BR:syz01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     MYO_120620 (odhB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding PASTA
Motif
Other DBs
NCBI-GeneID: 14617484
NCBI-ProteinID: AGF52302
LinkDB All DBs
Position
complement(2248924..2250225)
Genome map
AA seq 433 aa AA seqDB search
MIYDIFMPALSSTMTEGKIVSWTKSPGDKVEKGETVLVVESDKADMDVESFNEGYLAAIL
VPAGEEAPVGATLGLVVETEAEIAEAQAKAGSGGGSSAAPTATPAPQQPEPVAIASATAI
ETTPAPSSNGNGKGSGRIIASPRAKKLAKELKVDLATIAGTGPHGRIVAADIESAAGKPV
TASIAAPSAPAPKTSPAPTPRVTSTPSVPVGQTVPLTTFQKALVQNMVAAMAAPTFRVGY
TITTDGLDQLYKQIKGKGVTMTALLAKAVALALKKHPIVNASYTDQGIIYHKDVNIALAV
AMPDGGLITPVLQNADQVDIYSLSRRWKELVERARAKQLQPEEYSTGTFTISNLGMFGVD
RFDAILPPGQGGILAVGASRPQVVANEEGLIGTKRQMAVNVTCDHRVIYGAHAAAFLKDL
AVIIEENAQSLTM
NT seq 1302 nt NT seq  +upstreamnt  +downstreamnt
atgatttacgacattttcatgcccgccctgagttccaccatgaccgaggggaaaattgtt
tcttggactaagtcccccggcgacaaagtggaaaaaggtgaaactgtcttggtggtggaa
tcggacaaagcagatatggacgtggagtcctttaacgaaggttacctagccgccattcta
gttccagcaggggaagaagctcccgtgggggcaacccttggcctagtggtggaaacggaa
gcggaaattgccgaagcccaagctaaagctggctctggtggtggttctagtgcggctccg
actgcaaccccagccccccaacaacctgaaccagtggcgatcgccagtgcaactgccata
gagacaactccggcccctagcagtaacggcaatggcaaaggcagtgggcgaattattgct
tccccccgggcgaaaaaactagccaaagagttaaaagttgatttagctaccattgctggc
actggcccccacggcagaattgtggccgcagatattgaaagtgccgctggtaaacccgtc
actgcttccatcgctgcccccagtgccccagctcctaaaacatcccctgcccctactcca
agggtaacctctacccccagtgttcccgtcggccagacagtacccctgaccactttccaa
aaagctttggtgcaaaatatggtggccgccatggccgctcctacattccgagtgggctac
accatcaccaccgatggactggatcaactttataaacaaatcaaaggcaaaggggtgact
atgacggccctgttggctaaagctgtggctctggccttgaaaaaacatcccattgtcaac
gccagctacactgaccaaggcatcatctaccacaaggatgtcaacattgctctggccgta
gccatgcccgatggcggtttaattactccggtgttgcaaaatgcagaccaagtagatatc
tactccctctcccgccgatggaaagaattggtggaacgggcccgggctaagcagttacag
cctgaagaatacagcactggcactttcactatttctaacctgggtatgtttggggtagac
cgatttgatgccattctaccgccgggtcaagggggaattttagcggtgggtgcttcccgt
ccccaagtagtggccaatgaggaaggtttgattggtaccaaacgacaaatggcggttaat
gtaacctgtgaccatcgggtaatttatggggcccatgccgccgctttcctgaaggatttg
gctgtcattattgaagagaatgcccagtctttgactatgtaa

DBGET integrated database retrieval system