KEGG   Synechocystis sp. PCC 6803: MYO_126270Help
Entry
MYO_126270        CDS       T02468                                 

Definition
(GenBank) aldehyde dehydrogenase
  KO
K00128  aldehyde dehydrogenase (NAD+) [EC:1.2.1.3]
Organism
syz  Synechocystis sp. PCC 6803
Pathway
syz00010  Glycolysis / Gluconeogenesis
syz00053  Ascorbate and aldarate metabolism
syz00071  Fatty acid degradation
syz00280  Valine, leucine and isoleucine degradation
syz00310  Lysine degradation
syz00330  Arginine and proline metabolism
syz00340  Histidine metabolism
syz00380  Tryptophan metabolism
syz00410  beta-Alanine metabolism
syz00561  Glycerolipid metabolism
syz00620  Pyruvate metabolism
syz00625  Chloroalkane and chloroalkene degradation
syz01100  Metabolic pathways
syz01110  Biosynthesis of secondary metabolites
syz01120  Microbial metabolism in diverse environments
syz01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:syz00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    MYO_126270
   00053 Ascorbate and aldarate metabolism
    MYO_126270
   00620 Pyruvate metabolism
    MYO_126270
  Lipid metabolism
   00071 Fatty acid degradation
    MYO_126270
   00561 Glycerolipid metabolism
    MYO_126270
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    MYO_126270
   00310 Lysine degradation
    MYO_126270
   00330 Arginine and proline metabolism
    MYO_126270
   00340 Histidine metabolism
    MYO_126270
   00380 Tryptophan metabolism
    MYO_126270
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    MYO_126270
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    MYO_126270
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    MYO_126270
Enzymes [BR:syz01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.3  aldehyde dehydrogenase (NAD+)
     MYO_126270
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh UvsY
Motif
Other DBs
NCBI-GeneID: 14618051
NCBI-ProteinID: AGF52856
LinkDB All DBs
Position
2895978..2897348
Genome map
AA seq 456 aa AA seqDB search
MNTAKTVVAEQRDFFRQGKTKSVQDRLTALAKLKTQIQAQEEEIIKALKQDFGKPTFESY
VNEILGVIREINYYQKHLQQWSKPQRVGTNLMVFPASAQLRPEPLGVVLIISPWNYPFYL
CLMPLIGAIAAGNCVVVKPSEYTPAISGVITRLIQNVFSPAWATVVEGDETISQQLLQEK
FDHIFFTGSPRVGRLIMAAAAEQLTPVTLELGGKSPCVVDREINLQETAKRIMWGKLVNA
GQTCVAPDYLLVEQSCLEQLLPALQQAIQMLFGENPAHSPDYTRIVNQQQWSRLVSLLSH
GKVITRGDHNEGDRYIAPTLIIDPDLNSPLMQEEIFGPILPILTYQSLSEAIDFINIKPK
PLALYFFSNNRQKQEEILQSTSSGSVCLNDILLHLTVTDLPFGGVGESGMGRYHGKATFD
TLSNYKSILRRPFWGETNLRYSPYGKKMNLIKKLFS
NT seq 1371 nt NT seq  +upstreamnt  +downstreamnt
atgaatactgctaaaactgttgttgctgagcaaagggacttttttcgtcagggcaaaact
aaatcagtccaagatagattaacagctctagcaaaattaaaaacgcaaattcaagcccag
gaagaggaaattattaaggcccttaagcaagattttggtaagcccacctttgaaagctat
gtaaacgaaattttgggggtaattagggaaattaattattatcaaaaacatcttcagcaa
tggtctaagccccaacgggtaggtacgaatctgatggtttttcctgccagtgcccagtta
agaccagaaccccttggtgtagtgctaattattagcccctggaattatcctttttatctt
tgtttaatgcccttgatcggggcgatcgccgctggaaattgtgtggtggtaaagccgtcg
gaatatactccagctattagtggggtaattaccagattaatccaaaatgtattttccccg
gcttgggcaacagtggtggagggagatgaaaccattagccaacaattgttacaggaaaaa
tttgaccatattttctttaccggcagccctagggtgggtcggttaattatggcagctgcg
gcagagcaattaaccccagttacgttggaattggggggtaaatctccctgtgtggtggat
agggaaatcaacctccaggaaacagccaaacgcattatgtggggcaagctagtcaatgct
ggccaaacctgtgtggcaccggattatttattggtggagcaatcctgcttagaacaactt
ttaccagctttacaacaggcaattcagatgcttttcggggaaaatccagcccatagccct
gactacactcgcattgttaaccaacaacaatggtcacggttagttagtttattaagccat
ggcaaagtaattacaaggggagatcataacgaaggcgatcgctacattgccccaacttta
atcatcgatccagatttaaattctcccttaatgcaagaggaaatatttggcccaattttg
ccaattttaacttatcagagtttgtcagaagcaatagattttattaacatcaaacctaaa
ccattggcactttatttttttagcaataatcggcaaaaacaggaggaaattttgcaatct
accagttccggtagtgtttgtttgaacgatattttgcttcatttaactgtgacagactta
ccctttggtggggtgggagaaagtggtatgggacgctaccatggcaaggctacttttgac
acattgagcaattataaaagcattttacgacgacccttttggggggaaactaatttacgc
tattctccctatggcaaaaaaatgaatttaatcaaaaagttgttctcctag

DBGET integrated database retrieval system