KEGG   Siansivirga zeaxanthinifaciens: AW14_04225Help
Entry
AW14_04225        CDS       T03699                                 

Definition
(GenBank) phosphoenolpyruvate carboxylase
  KO
K01595  phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
sze  Siansivirga zeaxanthinifaciens
Pathway
sze00620  Pyruvate metabolism
sze00680  Methane metabolism
sze01100  Metabolic pathways
sze01120  Microbial metabolism in diverse environments
sze01200  Carbon metabolism
Module
sze_M00168  CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:sze00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    AW14_04225
  09102 Energy metabolism
   00680 Methane metabolism
    AW14_04225
Enzymes [BR:sze01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     AW14_04225
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPcase Gluconate_2-dh3
Motif
Other DBs
NCBI-ProteinID: AJR02961
UniProt: A0A0C5VUY8
LinkDB All DBs
Position
907279..909867
Genome map
AA seq 862 aa AA seqDB search
MSVEPKLSRFKQQVLSKYQIYNSIFMTLPFDTITKTGVLLPLFHETCKKGFANGDDPTKI
VDTFFEKYQGRRSKESQINLLFRFIQYIERQVVLFDAVEDAAFPIVNNMEGIGTLRNLKE
SASSNNKLEELKKYLEEFKVRIVLTAHPTQFYPGTVLGIITDLTAAIKSNNLSEINNLFA
QLGKTPFFKHEKPTPYDEAKSLIWYLENVFYHSFGEIYNYIQQNIYDDGKKHNEIINIGF
WPGGDRDGNPFVKPDTTLKVARKLKQAALKKYYADLKNLRRKLTFRGVEERIIRLETIMY
NYSININTPEKITAKELLKELLSIRNLIEEKHQSLYVNEINNLINRIHLFGFHFATLDIR
QDSRIHHSVFTNVVDHLIATGSKSFPKNYHDLTEAQQIEILSKVSDEKIDFDAFEDEMVY
NTLKTIEVIKDIQKTNGERGANRYIISNNQTALNVMQLFAMLKMVAFKDELTVDVVPLFE
TIDDLENAPKVMEQLYTNPVYMEHLKSRGNRQTIMLGFSDGTKDGGYLMANWGIYKAKEL
LTAMSRKYDITAIFFDGRGGPPARGGGKTHQFYSSLGPTIEDKEVQLTIQGQTISSNFGT
LDSSQYNLEQLISSGMFNRLGKENHKMSDEDKIVMADLAETSYAAYKEFKGHEMFIPYLE
RMSTLKYYAKTNIGSRPSKRGTSDKLVFSDLRAIPFVGSWSQLKQNVPGFFGVGTALKKY
EDKGEFYKVEQLYKNSKFFKTLLENSMMSLTKSFFDLTKYMSKDEEFGAFWNIIYTEYTT
TKALLLKLTGYKELMENEPSGKASIEVRESIVLPLLTIQQYALKKIQELNRSGVQDEEQL
KIYEKIVTRSLFGNINASRNSA
NT seq 2589 nt NT seq  +upstreamnt  +downstreamnt
atgtctgtagaaccaaaattatcgcgattcaagcaacaggtattgtctaaatatcagata
tacaacagtatatttatgaccttaccttttgatacgatcacaaaaaccggagtactactc
cccttatttcatgaaacctgtaaaaaaggatttgcaaatggagacgatcctaccaaaatt
gtagataccttctttgaaaaataccaagggagacgctcaaaagaaagtcaaataaacctt
ttatttagatttatacaatacatcgagcgccaagttgtattatttgatgctgtcgaagat
gccgctttccctattgttaacaacatggaaggtattggtacgcttagaaacttaaaagaa
tctgcttcttcaaacaataaacttgaagaattaaaaaaatatttagaagaatttaaagta
cgtattgttttaacagcgcatccaacacaattttaccctggaactgttttgggtattatt
accgatttaaccgcagctattaaaagcaataacctttctgaaattaataatcttttcgct
cagttaggtaaaacaccgttttttaaacacgaaaaaccaacaccttacgatgaagctaaa
agtttaatttggtatttagaaaatgtattctaccactcgtttggtgaaatatataactac
atacaacaaaacatttacgacgacggcaaaaaacacaatgaaattataaatattggtttc
tggccaggtggtgatcgtgatggtaacccattcgtaaaaccagatacaacgttaaaagtt
gctagaaaactaaaacaagcagcgcttaaaaaatattatgccgacttaaagaatttaaga
cgcaaacttacttttagaggggttgaagaacgtattattcgtttagaaaccattatgtat
aactacagtataaacataaatacgcccgaaaagattacggctaaagaacttctaaaagaa
ttattaagtattagaaatcttattgaagagaaacaccaatcgctttacgtaaacgaaata
aataatttaattaatagaattcatttattcggattccattttgcaactttagatattaga
caagacagtagaatacaccactcggtatttaccaatgttgtcgatcatttaattgcaaca
ggatcgaaaagtttcccaaaaaattatcacgatttaaccgaagcccaacaaattgagatt
ttatctaaagtttcagatgaaaaaatagatttcgatgccttcgaagatgaaatggtttac
aacacacttaaaaccattgaagttataaaagacattcaaaaaacaaatggcgaacgtggt
gcaaaccgttacattattagtaacaaccaaacagcactaaacgtgatgcagttgtttgcc
atgctaaaaatggtagcctttaaagatgaattaactgttgatgttgttccgctttttgaa
actattgacgatttagaaaatgcgcctaaagttatggagcaactatatacaaatcctgtg
tatatggagcatctaaaaagtcgtggtaacagacaaaccattatgttaggtttctctgac
ggtactaaagatggtggttatttaatggccaactggggtatttacaaggctaaagaatta
ttaactgccatgtctagaaaatatgatattacagcaattttctttgatggacgtggtgga
ccaccagcaagaggtggtggaaaaacgcatcagttctactcttctctaggtccaactatt
gaagacaaagaagtacaacttaccattcaaggacaaaccattagttctaattttggtact
ttagattcatctcaatataacctagaacaattaataagttctggtatgtttaaccgttta
ggaaaagaaaatcataaaatgtctgatgaggacaaaattgtgatggccgatttagccgaa
accagttatgcagcttataaagaatttaaaggtcatgaaatgtttattccttatttagag
cgcatgagtactttaaaatactatgctaaaactaatattggaagtagaccatcgaaaaga
ggaacatcagataaattagtattttccgatttaagagctattccttttgtaggttcatgg
agtcaattaaaacaaaatgtgccaggattttttggtgtaggtactgccttaaagaaatac
gaggacaaaggtgaattctacaaagtagaacaactttataaaaactctaaattctttaaa
acgcttttagaaaacagcatgatgtccttaaccaaatctttcttcgatttaacaaaatac
atgtctaaagacgaagaatttggagctttctggaatattatttacacagaatatacaact
acaaaagctttattattaaagctaacaggttataaagaattaatggaaaatgagccttcg
ggtaaagcttccattgaagttcgagagtctattgtattaccgttattaacgatacaacaa
tatgcattgaaaaaaattcaagagcttaatcgttctggagttcaagatgaagagcaatta
aaaatttatgaaaaaattgtaacacgctctttatttggtaatattaatgcgagtagaaat
tctgcttag

DBGET integrated database retrieval system