KEGG   Siansivirga zeaxanthinifaciens: AW14_04865Help
Entry
AW14_04865        CDS       T03699                                 

Definition
(GenBank) thymidine kinase
  KO
K00857  thymidine kinase [EC:2.7.1.21]
Organism
sze  Siansivirga zeaxanthinifaciens
Pathway
sze00240  Pyrimidine metabolism
sze01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sze00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00240 Pyrimidine metabolism
    AW14_04865
Enzymes [BR:sze01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.21  thymidine kinase
     AW14_04865
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TK
Motif
Other DBs
NCBI-ProteinID: AJR03064
UniProt: A0A0C5WCM9
LinkDB All DBs
Position
1046320..1046967
Genome map
AA seq 215 aa AA seqDB search
MFLENTVNHKEQFGWIEVICGSMFSGKTEELIRRLKRAQFARQKVEIFKPALDTRYDEDM
VVSHDANEIRSTPVPAAANIPILADGCDVVGIDEAQFFDDEIIRVCNDLANKGVRVIVAG
LDMDFKGNPFGPMPNLMATAEYVTKVHAVCTRTGNLAQYSYRKSSSDNLVLLGEVNEYEP
LSRAAYYKAMLRDKVRNMKVNEAEEIKPKPENPDA
NT seq 648 nt NT seq  +upstreamnt  +downstreamnt
atgtttcttgaaaataccgtaaatcataaagaacaatttgggtggatagaagttatatgc
ggctctatgttttctggtaaaaccgaggagttaatacgcaggcttaaacgcgcgcaattt
gcaagacaaaaagtcgaaatttttaaacctgctctcgatacccgttatgatgaggatatg
gtggtgtctcacgatgctaatgaaatacgttctacgcccgttcctgcggcagcgaatatt
cctattttagccgatggttgtgatgtggttggtattgacgaagctcagtttttcgatgat
gaaattattcgtgtttgtaacgatttagccaacaaaggcgttcgggttattgttgctggt
ttagatatggattttaaaggcaacccttttggacccatgccaaatttaatggcaactgcc
gagtacgttactaaggtacatgccgtttgcacgcgcaccggaaatttagcccagtatagc
taccgcaaatcgtctagcgataacttggttcttttaggtgaagttaacgagtacgaacca
ttaagtcgagcggcttattataaggccatgttgcgcgacaaagttagaaacatgaaagtg
aatgaggctgaagaaataaaacctaaacccgaaaatccagatgcctaa

DBGET integrated database retrieval system