KEGG   Siansivirga zeaxanthinifaciens: AW14_06145
Entry
AW14_06145        CDS       T03699                                 

Definition
(GenBank) 5-methyltetrahydrofolate--homocysteine methyltransferase
  KO
K00548  5-methyltetrahydrofolate--homocysteine methyltransferase [EC:2.1.1.13]
Organism
sze  Siansivirga zeaxanthinifaciens
Pathway
sze00270  Cysteine and methionine metabolism
sze00450  Selenocompound metabolism
sze00670  One carbon pool by folate
sze01100  Metabolic pathways
sze01110  Biosynthesis of secondary metabolites
sze01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:sze00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00270 Cysteine and methionine metabolism
    AW14_06145
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    AW14_06145
  09108 Metabolism of cofactors and vitamins
   00670 One carbon pool by folate
    AW14_06145
Enzymes [BR:sze01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.13  methionine synthase
     AW14_06145
SSDB
Motif
Pfam: S-methyl_trans Dioxygenase_C
Other DBs
NCBI-ProteinID: AJR03294
UniProt: A0A0C5WDH9
LinkDB
Position
1356229..1357230
AA seq 333 aa
MSNIKQALQERILVLDGAMGTMLQRYKFTEEDFRGERFKDYPTPLQGNNDLLSLTQPEAI
KTIHAKYFEAGADIVETNTFSGTTIAMADYQMEDLVYELNFQSAKIAKEVANAFTAKEPH
KPRFVAGSIGPTNRTASMSPDVNDPGYRAVTFDELRIAYKQQVEALLDGGADILLVETVF
DTLNAKAALFAIEEVKEARNIDVPIMLSGTITDASGRTLSGQTAEAFLISVSHIPLLSVG
FNCALGANLLQPHLEAIANKTDFAISAHPNAGLPNAFGEYDESPEEMGEQIEEYLKKNLI
NIIGGCCGTTPEHIKVIADIAAKYKPRKAVVSC
NT seq 1002 nt   +upstreamnt  +downstreamnt
atgtcaaacataaaacaagctttacaggaacgtattttagtgctagatggcgctatgggt
actatgttacaacgctataaatttaccgaagaagattttagaggtgagcgttttaaagat
tatccaacgccattacaaggtaacaacgacttgctatctcttacgcaaccagaagctatt
aaaaccatacacgctaagtattttgaggcaggtgccgatattgtagaaaccaatacattt
tcgggaacaaccattgccatggcagattatcaaatggaagatttagtttacgaattaaat
ttccaatctgctaaaattgccaaagaagttgctaatgcttttacagcaaaagaaccacac
aagcctcgttttgttgcagggtctattgggcctacaaaccgtacggccagtatgtcgcca
gatgtaaacgatccgggttacagagccgtgacgtttgatgaattacgaatagcctataaa
caacaagtagaagctttgttagatggtggcgccgatatattattagtggaaaccgttttc
gatacgctcaacgctaaagccgctttgtttgctattgaagaagtaaaagaagctcgaaat
atcgatgtgcctattatgttaagcggaaccattacagatgcttcaggacgtacattgtct
gggcaaacagccgaagcttttttaatttcagtatcgcatattccattattatctgtaggt
tttaattgtgctttaggggctaatttgttacaacctcacctagaagccattgcaaataaa
accgattttgctatttctgcacatcccaatgcaggattgccaaatgcttttggagagtac
gatgaatctccagaagaaatgggcgaacaaatagaagaatatttaaaaaagaatttaata
aatattattggcgggtgttgtggcaccacgccagagcatattaaagttattgcagacatt
gcagccaaatataaaccacgtaaagcggttgttagttgttag

DBGET integrated database retrieval system