KEGG   Siansivirga zeaxanthinifaciens: AW14_07165Help
Entry
AW14_07165        CDS       T03699                                 

Definition
(GenBank) superoxide dismutase
  KO
K04565  superoxide dismutase, Cu-Zn family [EC:1.15.1.1]
Organism
sze  Siansivirga zeaxanthinifaciens
Brite
Enzymes [BR:sze01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     AW14_07165
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Cu CHRD Big_3_5 Phage_T4_gp36 ASH
Motif
Other DBs
NCBI-ProteinID: AJR03438
UniProt: A0A0C5W8D5
LinkDB All DBs
Position
complement(1549386..1549955)
Genome map
AA seq 189 aa AA seqDB search
MKNLSILALVLAISLSSCKQTKKEVEVTETEITEPQPAIAKTFTIKLEPKSDSNVSGTAV
FTEENGSISMLATLTGLEPGTHAIHVHESSDCSSPDGKSTGGHWNPTNQPHGKWGAETGY
HKGDIGNFTADENGMATIKFSTTEWCIGCDDNTKNILGKAIIVHAGTDDFTTQPTGDAGG
RVSCGGIIE
NT seq 570 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaatttaagtattctagccttggtgttagccataagtttaagctcttgtaaacaa
acaaaaaaagaagttgaagtaactgaaacagaaattacagaacctcaaccagcaattgca
aaaacttttacaattaaattagaacctaaaagcgatagtaatgtttcgggaaccgccgta
tttacagaagaaaacggcagcataagtatgttagcaaccttaacaggcttagagccagga
acgcatgccatccacgtacacgaatcgtcggattgttcttcgccagatggaaaatcgact
ggtgggcactggaatccaaccaaccaaccacatggtaaatggggagcagaaactggatac
cacaaaggtgatattggaaatttcacagcagatgaaaacggtatggcaaccatcaagttt
tctaccaccgaatggtgtattggttgtgatgacaatacaaaaaatattttaggaaaagct
attattgtgcatgcaggaaccgatgatttcacaacgcaacctaccggagacgcaggaggc
cgtgtaagctgtggcggtattattgaataa

DBGET integrated database retrieval system