KEGG   Siansivirga zeaxanthinifaciens: AW14_07305Help
Entry
AW14_07305        CDS       T03699                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00632  acetyl-CoA acyltransferase [EC:2.3.1.16]
Organism
sze  Siansivirga zeaxanthinifaciens
Pathway
sze00071  Fatty acid degradation
sze00280  Valine, leucine and isoleucine degradation
sze00281  Geraniol degradation
sze00362  Benzoate degradation
sze00592  alpha-Linolenic acid metabolism
sze01100  Metabolic pathways
sze01110  Biosynthesis of secondary metabolites
sze01120  Microbial metabolism in diverse environments
sze01130  Biosynthesis of antibiotics
sze01212  Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:sze00001]
 09100 Metabolism
  09103 Lipid metabolism
   00071 Fatty acid degradation
    AW14_07305
   00592 alpha-Linolenic acid metabolism
    AW14_07305
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    AW14_07305
  09109 Metabolism of terpenoids and polyketides
   00281 Geraniol degradation
    AW14_07305
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    AW14_07305
   00642 Ethylbenzene degradation
    AW14_07305
Enzymes [BR:sze01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.16  acetyl-CoA C-acyltransferase
     AW14_07305
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: AJR03464
UniProt: A0A0C5WDZ9
LinkDB All DBs
Position
complement(1582553..1583743)
Genome map
AA seq 396 aa AA seqDB search
MKQAYIVKAYRTAVGKAPKGVFRFKRADELGAETIQYMMKELPQLDVKRIDDVIVGNAMP
EGAQGLNMARFISLIGLKSVDVPGVTVNRFCSSGIETIGIATAKIQAGMADCIIAGGVES
MSSVPMTGFKPELNYDTVKAGHEDYYWGMGNTAEAVANQFKVSREDQDEFAYNSHLKALR
ALSENRFQDQIVPINVEQIYINDSGKKATKLYTVTKDEGPRADTNLEALAKLKPVFAQGG
SVTAGNSSQMSDGAAFVMIMSEAMVKELNLEPIARLVNYAAAGVEPRIMGIGPVKAIPKA
LKQAGLKQTDLELIELNEAFASQSIAVIRELNLNPEIVNVNGGAIALGHPLGCTGAKLSV
QLFDEMRKRNMTGKYGAVTMCVGTGQGACGIFEFLN
NT seq 1191 nt NT seq  +upstreamnt  +downstreamnt
atgaaacaagcatatatagtaaaagcatacaggacagctgttggtaaagcgccaaaaggt
gttttccgttttaagcgggccgacgagttaggcgcagaaaccattcagtatatgatgaag
gaattaccacaactggatgttaaacgcatcgacgatgttattgttggtaacgccatgcca
gaaggtgcacaaggtttgaatatggcacgttttatatctttaataggattaaaaagtgtc
gatgttcctggtgtaactgttaatcgtttttgttcttctggtatcgaaaccataggaatt
gctactgctaaaattcaagcaggaatggccgattgtattattgcaggtggtgtagagagc
atgagctcggttcctatgacgggttttaaacccgaattaaactacgataccgtaaaagca
ggtcacgaagattattactggggcatgggtaatacagccgaagcggttgccaaccaattt
aaagtttccagagaagaccaagatgaatttgcatataattcgcatttaaaagctttacga
gccttatctgaaaatcgttttcaagaccaaattgttcccataaatgtagagcagatttac
attaacgacagcggtaaaaaagcaacaaaattatacaccgttacaaaagatgaaggtccg
cgagccgataccaacctagaggctttagcaaaattaaaacctgttttcgctcaaggcgga
agtgtaaccgcaggaaactcatcgcaaatgagtgatggtgcggcttttgttatgataatg
agtgaagccatggtaaaagagttaaatctagaacctattgcccgtttagtaaattatgca
gcagctggtgtagaaccaagaattatgggtattggtcctgtaaaagctattcccaaagca
ttaaaacaagcaggcttaaaacaaaccgatttagaattaattgagttaaatgaagccttt
gcctctcaatctattgctgtcattagagaattaaacttaaatccggaaattgtaaatgtt
aacggaggtgctatagctttaggtcacccactcggatgtacaggcgccaaattatcggta
caattgtttgatgaaatgcgtaaacgtaacatgactggtaaatacggcgctgttacaatg
tgcgtaggcactggacaaggtgcttgtgggatttttgaatttttaaactaa

DBGET integrated database retrieval system