KEGG   Candidatus Nitrosocosmicus oleophilus: NMY3_00971Help
Entry
NMY3_00971        CDS       T04185                                 

Definition
(GenBank) Undecaprenyl-phosphate mannosyltransferase
  KO
K00721  dolichol-phosphate mannosyltransferase [EC:2.4.1.83]
Organism
taa  Candidatus Nitrosocosmicus oleophilus
Pathway
taa01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:taa00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:taa01003]
    NMY3_00971
Enzymes [BR:taa01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.83  dolichyl-phosphate beta-D-mannosyltransferase
     NMY3_00971
Glycosyltransferases [BR:taa01003]
 N-Glycan biosynthesis
  Dol-P-Man biosyntheisis
   NMY3_00971
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glycos_transf_2 GtrA Glyco_tranf_2_3 Glyco_tranf_2_2 7TMR-DISM_7TM DNA_PPF
Motif
Other DBs
NCBI-ProteinID: ALI35176
UniProt: A0A0N7HBH9
LinkDB All DBs
Position
complement(898483..899712)
Genome map
AA seq 409 aa AA seqDB search
MTMLNLNDTISKTTEYKKFVSIIIPTFNESRNITDLLNQIQSNIPAGTNVEIIIVDDNSP
DGTGLIVEKYIKEKMGTLYRDQVNPSTSIKIIHRKEKTGLISALVNGISTSEGQNVLIMD
ADFSHPPEVINRMISELKKEPNCIIIGSRYITGGAINGMPLKRLLLSIGANFIARHGLCL
KNVYDPMSGFFAFPKHTLHGMEFNTDGFKILLEILIKKKNTVKVKEIPYTFKDRKYGQSK
LNFPIILEYIKAVWKLYRYGRKSKKQNTQLEKRKSVRFISKAARFYTVGFSGFVLNYLIS
ILLSNGILGSFGYLQATAVGIAVSVTTNFLLNKFWTFEDKNVNLTRFLRQYGMFIGCSSL
GILIQFLSIYMLRESGVPYDISLLVGVTIASVSNFLFNKKWTFKENIWG
NT seq 1230 nt NT seq  +upstreamnt  +downstreamnt
atgacgatgcttaatctaaatgataccatatcaaaaaccacagaatataaaaaatttgta
tctatcatcatacctacttttaatgaatctaggaatattacggatttacttaatcaaatt
caatcaaatatacctgcaggaacgaatgtagaaatcataatagtggacgataactcccct
gatggaactggtctgatagtggaaaaatatatcaaggaaaaaatgggcactttatataga
gatcaggtaaacccaagcacctcaataaagataattcatagaaaagaaaaaactggcttg
atttcggctcttgtgaacggaatcagtacaagcgagggccaaaacgtcctaatcatggac
gctgatttttcacatcctcccgaggtaataaacagaatgatatcagagttaaagaaagaa
cccaactgcattattatcggttctagatatattacaggcggagctatcaatgggatgcct
cttaaaagattattgcttagtataggagcaaattttattgccagacatggattatgttta
aaaaatgtttatgacccgatgtcagggttttttgcttttccaaaacatacacttcatggc
atggaatttaatacagatggatttaaaatattgttagaaattttaataaagaaaaaaaat
accgtcaaggtgaaagaaataccctacacttttaaggatcgaaaatacggacagagtaaa
ctcaactttccaataattttggagtatattaaggcagtttggaaactctatcgttatgga
agaaaatctaagaaacaaaacactcaattagaaaagagaaaatcggttcgattcatttca
aaggcggctaggttctacactgtaggattcagcggctttgttttaaattatttgatatca
attcttttatcaaatggtatcttggggagctttggatatttgcaagccactgcagtcggg
atagctgtatcagtaaccacaaatttcttgctaaataaattctggactttcgaagacaaa
aatgtcaatttgacacgattcttaaggcaatacggaatgttcattggatgtagttcattg
ggcatcctaatacagttcttgtcaatatatatgctcagagaatcaggagttccatatgat
atttcactcttagtaggagtcacaatagcatcagttagtaatttcttatttaataaaaaa
tggactttcaaggaaaatatatggggataa

DBGET integrated database retrieval system