KEGG   Tumebacillus algifaecis: CIG75_05580Help
Entry
CIG75_05580       CDS       T04994                                 

Definition
(GenBank) isocitrate dehydrogenase (NADP(+))
  KO
K00031  isocitrate dehydrogenase [EC:1.1.1.42]
Organism
tab  Tumebacillus algifaecis
Pathway
tab00020  Citrate cycle (TCA cycle)
tab00480  Glutathione metabolism
tab01100  Metabolic pathways
tab01110  Biosynthesis of secondary metabolites
tab01120  Microbial metabolism in diverse environments
tab01130  Biosynthesis of antibiotics
tab01200  Carbon metabolism
tab01210  2-Oxocarboxylic acid metabolism
tab01230  Biosynthesis of amino acids
Module
tab_M00009  Citrate cycle (TCA cycle, Krebs cycle)
tab_M00010  Citrate cycle, first carbon oxidation, oxaloacetate => 2-oxoglutarate
Brite
KEGG Orthology (KO) [BR:tab00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    CIG75_05580
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    CIG75_05580
Enzymes [BR:tab01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.42  isocitrate dehydrogenase (NADP+)
     CIG75_05580
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Iso_dh
Motif
Other DBs
NCBI-ProteinID: ASS74519
UniProt: A0A223CYN8
LinkDB All DBs
Position
1236204..1237493
Genome map
AA seq 429 aa AA seqDB search
MFEKYTAPTAGEKITIENGKLNVPNNPIIPFIEGDGTGPDIWNASVRVFEAAVEKAYKGD
KKIEWFEVLAGEKAFNQTGEWLPNDTLTAFREFLVGIKGPLTTPVGGGIRSLNVALRQEL
DLFACVRPVRYFNGVPSPVKHPELVDMVIFRENSEDIYAGIEYAEGTDEVKKLISFLREE
MGAKKIRFPETSGIGIKPVSKEGTERLVRAALDYTIQQNRKSLTLVHKGNIMKFTEGAFK
NWGYEVAEREYADKVFTWAQYDRIKDAEGTAAANQAQADAEAAGKIIVKDVIADAFLQQI
LTRPAEYDVIATLNLNGDYISDALAAQVGGIGIAPGANINYVTGHAVFEATHGTAPKYAG
LDKVNPGSVILSGVMMFEFLGWQEAADLIVNALEKAIDQKTVTYDFARLMEGATEVKCSE
FADALIKNL
NT seq 1290 nt NT seq  +upstreamnt  +downstreamnt
atgtttgaaaagtacaccgctccaactgctggtgagaagatcaccatcgaaaatggcaag
ttgaatgttccgaacaacccgatcatcccgtttatcgaaggtgacggtaccggtcctgac
atctggaatgcttccgtccgcgtttttgaagcggctgttgagaaagcgtacaaaggcgat
aagaagatcgaatggtttgaagtgctcgcaggtgaaaaggctttcaaccaaacgggcgaa
tggttgccgaatgacaccttgaccgcattccgcgaattcctcgtcgggatcaaaggcccg
ttgaccactccggttggcggcggtatccgctccctgaacgtcgcattgcgtcaagagctt
gacctgtttgcatgcgtgcgtccggttcgctacttcaacggtgttccgtccccggttaag
catccggaactggttgacatggtcatcttccgcgaaaactccgaggacatctatgctggt
atcgagtatgcagaaggcaccgacgaagtgaaaaagctgatctccttcctgcgcgaagag
atgggcgctaagaaaatccgcttcccggaaacgtccggtattggcatcaagccggtttcc
aaagaaggtaccgagcgtctggttcgcgcggcgctcgactatacgatccaacaaaaccgc
aagtccctgaccctcgtacacaaaggcaacatcatgaagttcaccgaaggcgctttcaaa
aactggggctacgaagtggctgagcgcgaatatgcggataaagtgttcacatgggcacaa
tatgaccgcatcaaggacgcagaaggcactgctgcggcgaaccaagcgcaagcggatgca
gaagctgctggcaagatcatcgtaaaagacgtgatcgccgacgcattcctgcaacagatc
ctcacccgtccggctgagtacgatgtcatcgcaactctcaacctgaacggcgactacatc
tccgacgcgctggctgcacaagttggcggtatcggtatcgctccgggtgcaaatattaac
tacgtaaccggtcatgcagtcttcgaagcaacgcacggtaccgctccgaagtatgcaggt
ctcgataaagtaaacccaggttctgtgattctctccggcgtcatgatgttcgaattcttg
ggctggcaagaagcggctgacttgattgtcaacgcgcttgagaaagcgattgatcaaaaa
acggtaacgtacgacttcgctcgcctgatggaaggcgcaaccgaagtgaagtgctccgaa
tttgcagacgcgctgatcaagaacctgtag

DBGET integrated database retrieval system