KEGG   Tumebacillus algifaecis: CIG75_08425Help
Entry
CIG75_08425       CDS       T04994                                 

Definition
(GenBank) branched-chain alpha-keto acid dehydrogenase subunit E2
  KO
K09699  2-oxoisovalerate dehydrogenase E2 component (dihydrolipoyl transacylase) [EC:2.3.1.168]
Organism
tab  Tumebacillus algifaecis
Pathway
tab00280  Valine, leucine and isoleucine degradation
tab00640  Propanoate metabolism
tab01100  Metabolic pathways
tab01110  Biosynthesis of secondary metabolites
tab01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:tab00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    CIG75_08425
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    CIG75_08425
Enzymes [BR:tab01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.168  dihydrolipoyllysine-residue (2-methylpropanoyl)transferase
     CIG75_08425
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding HlyD_3
Motif
Other DBs
NCBI-ProteinID: ASS75010
UniProt: A0A223D082
LinkDB All DBs
Position
1892335..1893684
Genome map
AA seq 449 aa AA seqDB search
MATILMPQLGESVTEGTIAKWLKQPGDTINKYDSIAEVITDKVNAEVPSEFVGTLTEILV
PEGATVSVGTPIAVIAEEGEASAPATAPKAEVASTPTAPAAAVSATAQVPSAPQRGEGGA
RFSPAVLRLIQEHNLDASQISGTGAGGRITRKDVLAFVEGGGATAPQATKTEAELSTVAA
PTKPATGLTEIGAQGAAAAPVAAPVSTPSVKPSYQAAEGDTVIEASGVRKTIARRMLESK
HNAPHAWTMMEADVTSLSKFRDKSKDAFKAKEGVSLTFLPFFIKAVVESLKEFPIINSTW
QDDKIIIKKDINISIAVATEDALFVPVIKNADRLSILGLSHAINDLAKRARAGKLTPDDM
SGGTFTVNNTGSFGSIQSMPIINAPQAAILSMEAIVKRPVVTPDDSFAIRSMMNMCMSLD
HRVLDGLVCGRFLQAVKKRIESYVEPNLY
NT seq 1350 nt NT seq  +upstreamnt  +downstreamnt
atggcaacgatcctcatgccgcagcttggcgagtctgtcacggaaggcacaattgccaag
tggctcaaacaacctggcgacacaatcaacaagtatgactcgatcgctgaggtcatcacc
gataaagtaaacgctgaagttccgtccgagtttgtcggcactttgaccgaaatcctcgtt
ccggagggtgcgaccgtctcggtgggcacgcctatcgcagtgatcgcagaagaaggtgaa
gcttcggctccggcaacagcgcctaaagctgaggttgcatcgactccgacagctcctgca
gcagccgtttctgcaaccgctcaggttccgtccgctccgcagcgcggggaaggcggcgct
cgtttctctccggccgttctgcgcttgatccaagagcacaaccttgatgcaagccaaatc
agtggtactggtgctggcggacgcatcacccgcaaagacgtgctggcctttgtcgaaggc
ggtggtgcaacagcaccgcaagcgaccaagaccgaagcagaactgtccactgtggcagct
ccgaccaagcctgcgaccggtctgaccgaaatcggcgcacagggagcggcagcagcacct
gtggcggcaccggtttctactccgtctgtcaaaccgtcgtaccaagcggctgaaggtgac
acggtgatcgaggcttcgggtgttcgcaagacgatcgcccgcagaatgctggaatcgaaa
cataacgcgccgcacgcttggacgatgatggaggcggatgtgacttcgctttccaagttc
cgcgacaagagcaaagatgcgttcaaagcaaaagaaggcgtgtccttaaccttcttgccg
ttcttcatcaaagcggttgtcgagtcgctcaaagagttcccgatcatcaactcgacatgg
caagatgataagattattattaaaaaagatatcaacatttcgattgcagtggcgacagaa
gacgcactgttcgttccggtcatcaaaaatgctgaccgtctgagcattctgggtctgtcc
catgcgatcaatgatctggcaaaacgcgcacgtgcaggcaagttgacaccggacgatatg
tctggcggcacgttcaccgtcaacaacaccggatcgttcggctcgattcagtcgatgccg
atcatcaatgcaccgcaagcggcaattctgtcgatggaagcgatcgtcaagcgcccggtc
gtgacaccggatgattcgtttgcgattcgttcgatgatgaacatgtgcatgtcgcttgac
caccgagttctcgatggactggtttgcggtcgcttcctgcaagcggtcaagaagcgcatc
gagtcctatgtggagccgaacctgtactaa

DBGET integrated database retrieval system