KEGG   Tumebacillus algifaecis: CIG75_09940Help
Entry
CIG75_09940       CDS       T04994                                 

Definition
(GenBank) hypothetical protein
  KO
K01971  bifunctional non-homologous end joining protein LigD [EC:6.5.1.1]
Organism
tab  Tumebacillus algifaecis
Pathway
tab03450  Non-homologous end-joining
Brite
KEGG Orthology (KO) [BR:tab00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03450 Non-homologous end-joining
    CIG75_09940
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:tab03400]
    CIG75_09940
Enzymes [BR:tab01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     CIG75_09940
DNA repair and recombination proteins [BR:tab03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    Two-component NHEJ DNA repair complex
     CIG75_09940
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DNA_ligase_A_M DNA_ligase_A_C RNA_ligase mRNA_cap_enzyme RVT_connect DUF5330
Motif
Other DBs
NCBI-ProteinID: ASS75274
UniProt: A0A223D1M5
LinkDB All DBs
Position
2246517..2247473
Genome map
AA seq 318 aa AA seqDB search
MSLPQPFEPMALFMVDKPFDDPNCIAQIKWDGVRMLAYLDATGLRLFNRRKNERTEQYPE
LQDLKGQVKARSLILDGEIVALGQGSKPTFTNILKRDLATRTDKIRLLTRQIPIYFMVFD
LLYADDRWLVEEPLTTRQERLFDMIQPSEQVRLVENHASAVHLYQVMQEQGMEGIVIKEK
MGRYHIGARHRTWIKVKNFRTLFAVVGGVTLRGGQVNALLLGVYQEGRLIYIGKAGSGLN
HEMIVALTSFVRQLPKQAQPFAHRPKLPSATAYDEIVFFPPQLVVEVQFMEWTNDMTLRA
PTIQGFCERDPKTCELHG
NT seq 957 nt NT seq  +upstreamnt  +downstreamnt
atgagcctgccgcagccgtttgagccgatggcgctcttcatggtggacaagccgtttgat
gatccgaactgcatcgcgcagatcaagtgggacggtgtccgcatgttggcctatctggat
gcaacaggacttcgccttttcaatcgccgcaaaaacgaacggacagagcagtatccggaa
cttcaggacttgaaagggcaggtcaaagcgcgctctctgatcctcgatggggagatcgtg
gcgctggggcaggggagcaagccgacgtttactaacatattaaagcgcgacctcgccacc
cgcaccgataagattcgcctgctgacccgtcagattccgatctactttatggtgttcgac
ttgctgtacgccgatgaccgctggctggtcgaagagccgctcacgacccgtcaagagcga
ctcttcgacatgatccagccgtccgaacaggttcgcttggtcgagaaccatgcatccgct
gtgcatctgtatcaggtcatgcaggagcaggggatggaaggcattgtgatcaaagaaaaa
atgggtcgctaccacatcggagcgcgccatcggacatggatcaaagtgaaaaacttccgc
actttatttgcggttgtcggtggagtcaccctgcgtggtggccaggtcaatgcactgctg
ctcggtgtttatcaggagggcaggctgatctacatcggcaaagcgggttcggggctgaac
catgagatgatcgtagccttgacctcctttgttcgccaactgcctaaacaagctcagccg
ttcgctcacaggccgaaattgccttctgctactgcttatgacgaaatcgtcttcttccct
ccacaactggtggttgaggtgcagtttatggagtggacgaacgatatgacgttgcgcgcc
ccgacgattcaagggttctgtgagcgcgatccgaagacgtgtgagttacatggatga

DBGET integrated database retrieval system