KEGG   Tumebacillus algifaecis: CIG75_10345Help
Entry
CIG75_10345       CDS       T04994                                 

Definition
(GenBank) hypothetical protein
Organism
tab  Tumebacillus algifaecis
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Condensation AMP-binding PP-binding AMP-binding_C LolB
Motif
Other DBs
NCBI-ProteinID: ASS75351
UniProt: A0A223D1C6
LinkDB All DBs
Position
2376288..2398952
Genome map
AA seq 7554 aa AA seqDB search
MKTSIPIFSTLPELLQTRAHLSPEKLAYSFLTTDGDEETVTYQELDRNARMLAATLQEHS
PGERVLLLYPPGLSYIRAFFGCLYAGLVPVPAYPPRTNGHLDRLQAIIHDSQAKLALTTP
SILNGIELQQSNFRELQDIEWIVTSSWEGSGSTGWRPPAVDGDSLAFLQYTSGSTALPKG
VMLTHHNLLHNLQAIENSFETNEASRCVIWLPPYHDMGLIGGILQPLYTGYPVTLMAPVD
FIQRPYFWLQTISRLGGTVSGGPNFAYDLCVQKITPEQRDTLDLSTWKVAFTGAEPVRSE
TLDRFADFFAPCGFQREAFYPCYGLAEGTLFVTGGRIEEAPVIQPFNADLLQQGRASKVE
PVFEHAQTLVSSGRLTDGQQSIVIASPDTLSLCSEGEVGEIWVKSPSVAQGYWNRREQTE
EVFHAFLTDTGDGPFLRTGDLGFAQDQELFVTGRLKDLVIIRGRNYYPQDLEFCVQKSHQ
AVHNNNGAAFSIELDGEEKLVIVQEVERQYRRSNLQPVLDLIRQSIAEEYQLQVHEIVLI
KPVSIPKTSSGKVQRHLCRARYLNNTLDVLCTDGSQSELLKLDQIQEERPDQSLADPQGW
ITDAPEQRLEKVRSHLQAQLAQLLRMTSAHPPSDRPISQFGLDSLVAVQFKDEIQGAFGV
SLQLSQLLSGPTLDQLALSIIENRSAADLEETGIAPDNNELTGETTGLSYGEQSLFFLQN
MHPEDTAYNIARAAKVSGAFDVDAWHRAILQLTKRHPQLRTRYTLQDGMPVRAIQETAEV
GWLYQDAQAWSEVELQDRMITESHRPFDLENDCLLRTCIWKRSETEHILLLIAHHIIVDF
NSFGVMVQDLQTLYQAEIRLSSDATEASSSLGYGGYESFVRKQMALLQSAEGERQRQYWH
RKLGGELPVLQMPSAHARPAIQTYKGAASLFQLSADVSAGVRRLALEHGMTIYSTLLAAF
QAILHRYTGQDDLLIGSPTSIIESAHEVSDIGYYVNPVVIRTDFKADPTVRELLGQVRQH
VLEALDHAEYPFALLVEDLQPERDLSFPPLFQAMFTYQRSQLPELKELTAFSLGMKGGSF
NLGQLAFESLPLQQNHAGFDLSLAMAEVEGTLAGRFEYNTDLFSDELIERLIEHFKTLLA
AFVTSPDRLVAELPLLTESEWQQQLIDWNRSTCDFPEVLSVHRLFEEQVRRTPDRIAVSF
DDVSLTYQQLDELANRRADQLLALGIEKETLVGLYLNRSHELIVSILAIWKAGGAYVPLD
PSHPQERVIFTLQDARAAVLVTESSLLSTWMDEIEQVLCIDVDRKDQQMIDRQVHPQSHP
HQLAYVIYTSGSTGQPKGVQIEHRSLTNLLFSLQNKLSFSERDVLVAVTTITFDISTVDL
FLPLITGAQVVVANSDQVADARLLAQLLQEKNATVLQATPATWYQLINSGWQGKQDLLVM
SGGESMPRALADDLLMRSREVWNLYGPTETTVYATGGRVGAQGTVLIGEALDNVEAYVLD
AHLQPVPLGAKGELYVGGVCLARGYLNRLELTAEKFIPHPFSSSDEARLYKTGDIARYQA
DGNLEILGRVDNQVKVRGYRIELGEIEATLTEHQEVKQAAIIVTDAGDGDVRLIGFVTMK
FAVTATTLKRKELRHFLKSRLPDYMVPAHLVILEEMPLTTSGKVDRKALKVPDEYYAEQA
GVVQLDTETEKIVAEIWSKVLRVEQLGAQSNFFELGGHSLLATQVTTRMQDAFGLTIPLR
QLFECPTVAEMASWIEGATQEAPNDLSKHRLLTPISRAGELPMSYAQQRLWTLDRLIDDP
AAYNMPFAIRLQGNLKEAALEQSLSLIVNRHEALRTTFAEVDGAPIQMIAPPAPVLVMKR
DLSNDSSAERELTLERLLQEVAGLAFDLQSGPLIRFCLVKTADQEHVLIINMHHIIADGW
SIVLFREEFVASYSALAEGRSPDLAELSLQYADFASWQRDWLQGSVLEEQLNYWNQQLAG
TLPTLELPIDHQRPALQTQRGKVERFTLSEELTVRLRALSSEHGVTMFMTLLSAFNLLLA
RYSGTPDICVGTPIAGRHHREVEPMIGLFVNTLVIRTDLSENLTFAELLSRVRETALNAF
AHQDVPFEKLVEVLVPTRDLSRTPLFQVMFDLQEDILTKIELPDLALTPIEFDSEHAKFD
LTLAMVDRERQLSGSFEYNADLFESATIKRMLVHFEQLLCSITERSTERISALSMLTSNE
RSTLSAYGSGVKRAIPQHLCVHQLFEAQAEKTPDSKAIEWKSGSLSYKELNRRANQLAHA
LIRAGVRVDQPVGLCVARSPEMIIGMLGIMKAGGAYLPLDPAYPAQRITYMLEDADADVL
LTQSGCIPANVQGRTVFLLDADHDRFDQECEENPATDVRSDHLCYIIYTSGSTGAPKGVE
IEHRNVVNHNLAIAEEYSLQPHDRVLQFSSISFDIAVEEIFPTLVTGGTLYIRDEEMLTT
AERFLREIDERKLSVLNLPTAFWSSWTHELAELGAKLPESLRLMIVGGEKASPEALTTWQ
RIAPEIDWINAYGPTETTVTATLFRSKGSSTRLGSIPIGRPIANLEAHILDAHLQPVPIG
VVGELYLSGAGVARGYRDRPELTASVFLNSPFHEEGSARLYKTGDLVRWLRDGQLEYVGR
VDDQVKIRGFRIEAGEIESCLEQLPTIQEAIVLPVEEIPGNPRLIAYLVTSDRFDEQEVV
ASLKASLPDYMIPSAWVTLDKFPLLPNGKVDRRALASIQSTAPDRLTEVVPRTEMEQQLA
SVWEKVLRRDSVGIHQNYFELGGDSILSIQLASRAAAQGIHLSPKDLFQHPTIAQLAQVA
KWANEKGTDAEEEPTAGPAPLTPIQRWFFELHHESPHQWNMPLLVDLKVPLDLQVLKESL
RALFLHHDALRMRIVQTERGWEQQFDESIGDVPFERLDLTNLSADEEEAVWRAEVVKWQE
SLNLFTGPIARFVYLDRGENRSHRLFCLVHHLAVDGVSWRILLEDLERIYEQLLHGEAVR
LLRKTTSVQRWARVLAQRAQEVEMEKELTYWLDQNVAADPLPVDDSAGRNTYSSLRRKRM
FLDPASTRALLQEAPRAFRTSVQDLLVTALAQTIADWTKGEHVSLELEGHGREELFEHAN
LSRTVGWFTATYPIHLHLQNPDDPADSLKRVKEQLRSVPRGGVGYGLLRFIGREEGRSAL
RKAPQPQVLFNYHGQTDMQFDSSNLFALSAEEVVASHGADNLRSHLLEINGAIVDHRLQL
DWEYSDQFHSADTIELLVNSFYDHLQKLIQLCFSPEGRGRTPSDYPNAELDQERLDRFLS
QLESRGFPLENIEDLYPLSPMQQGMLYHSNLVEEKGMYLVQMTLHLRGNLKVDVLERAWQ
WVVDRHTILRTSFHWQSLQVPLQVVHQQVPITIRSLQEDEHQQVVQQFLDEERTVGFDLS
SAPLCRLTLAEIDSEQSKLIFTSHHLVSDGWSLPLIFQELFAAYVAFDQEQLPQQPTALP
FVRYIAWLQQQELQSAENFWRGYLDGFSTPLRLGIRKRGTEQTLPSSLPQEQHAALSTSV
TEQLVRMSKQQQLTLNTIVQGAWSILLSRYSGNDDVLFGATFAGRPADLLGSDEMVGLFI
GTLPIRVQIESTQAVLPYLRALQQRQSEVREYEYTPLVDIQKWSEVSHGQALFDTIFVFE
NYPMDRSLTENVGGLLVEEIMSEEWNNYPLTLTVVPGSKLMLKAMYDQSLYDDRDIERLL
VHLSTLIEQIVSQPEQTIGKMPMLTAEEVNQQLVEWNDRSWMSTSDLSILRLIEEQAERT
PDRTAIQFGQERLTYREVTQRVDARAQQLRALGVTRDALVGLYLNRSHEWVISILAIWKA
GGAYVPLDPAHPVERVTRCLQDAQPAVLLTESKLVEPWMNEMNHLLCVDSSAELRANDQP
VWEAIKSEQPAYVIYTSGSTGVPKGVQIEHRSLTDFLLTMHQRLSFSEREVLVSVTTISF
DISILELFLPLISGAQVVIAEAEVAADGKRLGQLLEAAQATVLQATPATWYLLIHAGWLG
KHDLRALCGGENLPRDLADDLLARVGEVWNLYGPTEATVWATAGKVALSEPVSVGRPLEH
VETYVLDVSLQPLPVGVVGELYLGGSCLATGYRNAPELTANAFIPHPFASEPASRLYKTG
DLARYLPDGSLEILGRTDHQVKVRGFRIELGEIEEVLLQHPEVHRAVVVVQDAAVGDKRL
IAYFVQAADQPSVESGELRRFLKQRLPDYMVPSAFVSLTQLPLTPNGKVDRKALPQPAEF
ASAERAYVAARTETETMLSQLWSSVLRNKRIGMHDNFFELGGHSLLATQAVALMQEKMGI
DLPLRTLFEHPTVAEFAAWIEERTATGNHSFAVVPQLPIARPSKLPLSFAQQRLWMLDQL
LPDRAAYNMPFAVRMEGALDLAALELSLHEIICRHEILRTTFAEQAGEPIQVIHAPQQET
LLVIDLSDRADGERKERLEQLIAEEEKRAFDLQVGPLLRQKLVRLGEFEHVLLMTFHHII
FDAWSIALFVEELVSLYEAAHEQTLAQLPKMELQYADFTLWQRDWLQADVMEEQIQYWKQ
QFHGEIPILQLATDRPRPAVQSARGAAERLVLDEELTAALRSFSQEHELTLYMTLLGAFY
ILLYRYTGQEDLVVGTPIAGRRHRHAEKLVGLFVNTLPLRLDLAGAPTGEEVFERVRQMM
LGAYSHQDVPFERLVEELQPTRDMSRSPLFQVMFGLQSTQLTEQKLTGLTLNLIDKETPF
AKFDLNLVLLEEGGTVSGWWEYNADLFDRQTIQRMMLHYQQLLRSLLEGSTSQPEQAIGK
LPMLTVEEVNQQLVEWNNRSWMSNSDLSVLHLIEEQAERTPDRTAIQFGQERLTYREVTQ
RVAARAQQLRALGVTRDALVGLYLNRSHEWVISILAIWKAGGAYVPLDPAHPVERVTRCL
QDAQPAVLLTESKLVEPWMNEMKHLLCVDSAVEVRANDQPVWEAIKSEQPAYVIYTSGST
GVPKGVQIEHRSLTDFLLTIQQRLSFSEREVLVSVTTISFDISILELFLPLISGAQVVIA
EAEVAADGKRLGQLLEAAQATVLQATPATWYLLIHAGWLGKHDLRALCGGENLPRDLADD
LLTRVGEVWNLYGPTEATVWATAGKVALSEPVSVGRPLEHVETYVLDASLQPLPVGAVGE
LYLGGSCLATGYRNAAELTAKAFLPHPFASGPASRLYKTGDLARYLPDGSLEILGRIDHQ
VKVRGFRIELGEIEEVLSQHPEVHRAVVVVQDAEVGDKRLIAYFVQTADQPSVESGELRR
FLKQRLPDYMVPSAFVSLTQLPLTPSGKVDRKALPQPADFVSAERAYVAPRTETETMLTQ
LWSSVLRVDRIGMHDNFFELGGHSLLATQAVALMQEKMRIDLPLRALFEHPTVAEFAAWI
EERTATGDLSFAVLPQLPIARPSKLPLSFAQQRLWMLDQLLPDRAAYNMPFAVRMEGALD
LAALELSLHEIICRHEILRTTFAEQAGEPIQVIHAPQPETLAVIDLSDRADGERKERLEQ
LITEEEKRAFDLQVGPLLRRTLVRMGEEEHVLLMTFHHIIFDAWSIALFVEELVSLYEAA
HEQTLAQLPKMELQYADFTLWQRDWLQADVMEEQIQYWKQQFHGEIPILQLATDRPRPAI
QSARGAAERLVLDEELTAALRSFSHEHELTLFMTLLGAFYILLYRYSGQEDLVIGTPIAG
RRHRHAEKLIGLFVNTLPLRLDLSGAPTGAELFERVRQMMLGAYSHQDVPFERLVEELQP
TRDMSRSPLFQVMFGLQSTQLTEQKLSGLNLNLIDKETPFAKFDLNLVLLEEGGKVSGWW
EYNADLFDRTTIQRMMQHYEQLLRSILNGPVSEISRLPLLAASERARLLQLPHPAEMRRS
SEQTLHQQFEAMVERTPDRVALVFESNSLTYRELNERANRVAAHLLSLGVQPNTLVGLCT
ERSLELVIGLLAILKAGGAYVPLDPAYPADRLAFLLQDASLSILLTQQHLRNTLPAHRAQ
VVCLDDHALFASASADNLHSAATAESIAYVIYTSGSTGQPKGVPIPHANVIRLFTSTAHW
FPFAEDDVWTLFHSFSFDFSVWELWGALLHGGKAVIVPYWISRSPEAFLHLLASERVTVL
NQTPSAFRQLMQAEAAQSDRQALSLRWVIFGGEALDLPALRPWFDRHGDQSPQLINMYGI
TETTVHVTYRPLKREDALRANSVIGHPIPDLEVYVLDPHLEPVPIGVAGELYVSGAGVAP
GYLHRPELTAERFLHHPFRAEAQARLYKTGDLARRLPSGELEYLGRIDHQVKIRGFRIEL
GEIESMIGHHPGVRETAVLVREDRADDKQIVAYVVTHVGTELQPSDLLSHCKERLPDYMV
PAAFVLLDALPLTHNGKLDRNALPAPIGQQKDRTIRSQPESATEIAISEIWKEVLGVEQI
DREDNFFDLGGHSLRATQAVSRIGATLGIKLSLRTLFETPTLRLLAEEVQHQQMKEMPVS
TQAICQQSRIGEIPLSFAQERLWVLDRLMPGNTAYNIPFALSMIGELDDEALEWSINEII
KRHEILRTTLHQVESSAVQRIAKPDWQRLTRTDLRSLSSADWEREVSARLQAETERVFDL
TAGPLLYVELLQRASDDHALVINMHHIISDGWSIGLLVQEIGALYTAYVEGQTSPLADLS
IQYADYAIWQREWLAGQRWDEQLSYWKTQLGGSLPALQLPTDHPRPPVQSYRGASFAFAI
DKVVVEALEAIGKSHSATLFMTLFSVFQTLLYRYTGQEDLVVGTPIAGRQQQETEGLIGF
FVNTLVMRTDLSARQTFVELLAQVRQTALDAYTHQDIPFEKLVAELQPIRDRSRSPLFQA
MFALQSASQACLSLPGLAIQQIEGATTTAKFDLSVTFEESEQGLNGHLEYSTDLFEASTI
ARMADHLVTLMNSVIENPNTPVSELQMVTEAEKRLFSEWNGELPSPADQCVHRLFESQVI
RTPDRIAVEHEGNELSYRELNARANQLARHLQALGVGPEMPVTFCLDRSLDLVIAQLAIL
KAGGAYVPIDPNNPPERTAFILQDTNALVMVAHSHLIRELPNLPAQLVCLDQDEDVLSAY
SGEDVSSDVRPDHLAYLIYTSGSTGRPKAVAVEHRNVLSTLLIAQEQFVFRESDVIMWTS
SAAFDISQFELWSTLFVGGRILLLSRDHILNIDRMIVDLTRATVVNFVPNLMRRVIEATK
SAIQEGTRFDNLRYLFIGGDAVPPQMLVETNQTFPRTDTYVLYGPTEASIFATSHLAKRG
EEGDRILIGKRCLNAQLYICDPFDQEVPLGVPGELQIGGLGVAREYFGREELTAEKFVTV
DGQRRYKTGDLVRYLPDGSIEFLGRIDGQVKIRGFRIEIGEIEAALTQQPDIVDAVVQVH
ETAAGEKRLIAYVARSEEGKLDVRSLRHELQKRLPDYMIPARFIQLEALPLNPNGKVDRK
ALQTLEWPAMDSEDFAQPSTPTETKVAAIVANLLSLQQIGVHDNFFELGGHSLLAMQAIA
EIRAELKVEVPLSALFEAPSIAELSAMIDILLNETPQQESSIKRASRSAHARRR
NT seq 22665 nt NT seq  +upstreamnt  +downstreamnt
atgaaaacttcaatcccgatcttttctactctacccgaacttttgcaaactagagcgcac
ctttctccagaaaaacttgcctattcatttctaacaacagacggagacgaggagacggtt
acttatcaagagctcgatcgaaatgcgcgcatgcttgctgccacgcttcaagagcattcg
ccaggcgagcgtgtgttgttgctctacccgcctggtctttcctatatacgtgcttttttt
ggatgtttatacgccggattggtgccagtcccagcctatccgccgcgtacaaacggtcat
ctcgaccgattgcaggcgatcattcacgattcacaagccaaactcgcattgacaaccccc
tcgattctaaacggaatcgagctgcagcaatctaactttcgcgaactgcaagacatcgag
tggatcgtcacctcgtcatgggaggggagcggttcgaccggctggcgaccacctgctgtt
gacggggacagccttgcgtttcttcaatatacatccggctcaacagccttgccgaaaggt
gtgatgctgacacatcacaacctgttgcacaatctacaagcgatcgagaacagtttcgaa
acgaatgaggcaagccgctgtgtgatctggctgcctccttatcatgatatgggattgatc
gggggaatcctccaacccttgtacacaggatacccggtcacgctgatggcacctgtcgat
tttattcaacgaccctatttttggttgcagacgatctctcgactaggtgggacggtgagc
ggtgggccgaactttgcctacgatctttgcgtgcaaaaaatcacacctgaacaacgagat
acattagatctcagcacgtggaaagtcgcatttacaggcgcagagccagttcgctccgag
acactggacagatttgctgactttttcgctccctgtggatttcaacgggaagctttttac
ccgtgctatgggttggccgaagggactctgtttgtaactggcggacgaatcgaagaagca
cctgtcatccaaccattcaatgctgatcttttgcaacagggtcgtgcatccaaagtcgag
cctgtgtttgagcatgcccaaacattggtgagcagtggtcgacttactgatggtcaacaa
agtattgtgatcgcatcccctgatactctctctttgtgttcagaaggtgaagtaggcgag
atctgggtaaagagtcccagtgtcgctcaagggtattggaaccgtagagagcagacggaa
gaggtgtttcatgccttcctgacagatacgggagatggccccttcctccgcacaggcgat
cttggatttgcccaagatcaagagttattcgtgacgggacgactgaaagacctggtcatc
attcgaggtcgcaactattatccgcaggatcttgagttttgtgttcagaagagccatcaa
gccgttcataacaacaacggtgccgctttctccatcgaattggatggggaagagaagctg
gtcatcgtgcaagaggtggagcgtcaataccgcagatcaaacctgcaaccggttcttgac
ctgattcgacagtcgatagcagaagagtatcaactacaggtgcatgaaatcgttctgatc
aagccggtcagcatccccaagacttccagcggaaaagtacagcgacatctctgccgagca
cgttatttgaacaatacgttagatgttctctgtacagatggttcccaatctgaactgttg
aagctcgaccaaattcaagaggagagacccgatcagtccctcgcagatccgcaaggttgg
atcaccgatgcgcctgagcaacgactggaaaaggtcagatcgcaccttcaagcccagttg
gcgcagctgttgcggatgacatccgctcatcctccgtcagatcgcccgatcagtcagttt
ggacttgattcgctggtagctgtccaattcaaggatgagattcagggtgcctttggagtt
tcactccaactttcgcaactgctgtcagggccaaccctcgatcaattggcactttcgatc
atcgagaaccgcagtgctgcagatcttgaggagacggggatcgctcccgataacaatgag
ctcacaggcgaaacaacaggactttcgtatggcgagcagtcccttttcttcttgcagaac
atgcatcctgaagatactgcgtacaacatcgccagagcagcaaaggtgagcggcgctttt
gatgtggacgcttggcatcgtgccatccttcagttgacgaagcgacacccacaacttcgc
acccggtacacattgcaagacgggatgccagttcgagcgatacaggaaacggcagaagtg
ggatggctctatcaggatgctcaagcttggtcagaagttgagctccaagatcgaatgatc
accgaatcgcatcgtccgttcgacttagaaaatgattgtttgttgcgaacttgcatctgg
aaacgttcagaaacggagcacattcttttgctcatcgctcatcacatcattgtcgatttt
aactcgttcggcgtgatggttcaggatctgcaaaccttgtatcaagcagagatccgactt
tcttcagatgcgaccgaggcctcttccagcctaggctacggcggctacgaaagctttgtg
cgaaaacagatggcgttgcttcagagcgctgaaggcgaacgccaacgtcaatattggcat
cgcaaattagggggggagttgcccgtacttcagatgccatccgctcatgctcgccctgcg
atacagacctataaaggcgctgccagtttgtttcaactgtctgcagacgtctcggcgggg
gtgcgccgactcgcacttgagcatggcatgacgatttacagcacgctcctcgccgcattt
caagccattttacatcgctacacaggtcaagatgatctgctgatcggctctccgacatcg
atcattgaaagtgcacatgaagtttccgatatcggttattatgtaaacccggtcgtcatt
cgaaccgacttcaaagctgacccgaccgttcgagaactgctcggacaggttcgccaacat
gttctcgaagcgctcgatcatgccgaatatccattcgctctcttggtcgaagacttacaa
ccagagcgcgacctaagtttccctccgctctttcaggcgatgtttacctaccaacgctct
caattgcccgagctgaaggagttgaccgctttttcgctcggtatgaaggggggcagtttc
aatctaggtcagcttgctttcgagtcgcttccgcttcagcaaaatcatgctgggttcgat
ctgtccttggcgatggcagaggtggaggggactctcgctggacggtttgagtataatacc
gatcttttcagcgacgagttgatcgagcgattgattgagcatttcaaaactttgctcgca
gcttttgttacttctcccgatcgtttggtcgctgaacttcccctgctgaccgaatctgaa
tggcagcagcagttgatcgactggaaccggtcgacttgcgattttcctgaagttttgtct
gttcacagattatttgaagaacaggtaagacgaacacctgatcggatcgccgtctcattt
gatgatgtgtcgctgacgtatcaacagttggatgagcttgcgaaccggcgtgcagatcag
cttctcgcattaggtatcgaaaaggaaacgttggtcggtctgtacttaaatcgatcccat
gagctgatcgtctccattcttgcgatctggaaagcgggtggggcctatgttccgctcgat
ccgtcacatcctcaggaacgtgtgatatttaccctgcaggatgcgcgtgccgctgtgctc
gtcacagagtccagtctgctcagcacctggatggatgagatcgaacaggtactatgcatc
gatgtagatcgcaaggatcagcagatgatcgatcgtcaggtgcacccacaatcccaccca
catcagctggcctatgtgatctacacgtccggctcaacaggacagccaaaaggggtacag
atcgaacatcgctcgctgaccaacctgctgttttctcttcaaaacaagctctcatttagc
gaacgcgacgtgctggtcgctgtgacgacgatcacattcgatatctcgacggtagatctg
ttcttgccgctgatcaccggagcacaggttgtggtggcaaattcagatcaggtggcagat
gcccgcctgctcgcgcagctgttgcaagaaaagaacgcgactgttctccaagcgacgcca
gcaacatggtatcagctgatcaattctggctggcaagggaagcaagatctgctggtgatg
tcaggcggagagagcatgccgcgagcgctcgccgatgatctcctcatgcgcagccgagag
gtttggaatttgtacggcccgaccgaaacgacagtctatgctacgggagggcgtgttgga
gcacaggggacggtgttgatcggagaagcgctcgacaatgtagaggcgtatgtgttggat
gcgcacttgcaaccggtgccgctcggtgcaaaaggtgaactttatgtcggaggggtctgc
ttagcacgcggatatttgaatcgcctcgaactgacggccgaaaagttcattccacaccct
ttctcttccagtgatgaagcgcgtctgtacaagacaggcgacatcgctcggtatcaggct
gatggaaacctggaaattctcggcagggtggacaatcaagttaaagtgcgcgggtatcgc
attgagctaggcgaaatcgaagcgaccctcaccgagcatcaagaggtgaaacaagcggcg
atcatcgtcaccgacgctggtgatggagatgtgcggttgatcggctttgtcacaatgaag
tttgccgtgacagctacgacactgaaacgcaaggagttacgccattttctgaagagccga
ttgccagactacatggtgcctgcccacttggtcatcttggaagagatgccgcttaccacc
agcgggaaagtggatcgcaaagcattgaaagtaccagatgagtattacgctgagcaggca
ggagttgtccagctcgacaccgagacggaaaaaatcgtcgcagagatctggtcgaaagtc
ctgcgagtggagcaactcggagcgcaaagcaacttttttgaactcggcggtcactccttg
ttagcgactcaggtgacgacgcgcatgcaagacgcgttcggactcaccatcccgcttcgc
cagctgttcgaatgtccgactgtcgctgagatggcaagctggatcgagggtgcgactcag
gaagcaccgaacgatctgtcgaaacatcgactcctcaccccgatctctcgtgcgggagaa
ctaccgatgtcatacgctcaacaacgtctttggacgttagatcgcctgatcgacgatcca
gctgcatacaacatgccgtttgcgatccgcttgcaggggaacttaaaagaagcagcattg
gaacaaagtttatcgttgatcgtcaaccggcatgaggcgcttcgaacaacgtttgctgaa
gtggatggtgctcccattcagatgatcgcacctcccgctcctgtcttggtcatgaaaaga
gatctgagcaacgattcgagcgcggaacgagaattgacgcttgaacgtctgttgcaggaa
gtagcagggcttgcgttcgacctgcaaagcggccctttgattcgtttttgcttagtcaaa
acagccgatcaggaacatgtgctgatcatcaacatgcatcatatcatcgcggacggttgg
tctatcgtattgttccgtgaggagtttgttgcaagctacagcgcgctcgccgaagggcgc
tcaccagatttggcagaactgtcacttcagtatgcagactttgcaagttggcagcgagac
tggttgcaagggagcgttttggaagagcagttaaactattggaatcaacagttagcaggc
acgctgccaacgcttgaactaccgatcgatcatcagcgacccgccttgcaaacacagcgc
ggaaaagtagagcgattcacactttctgaagaattgactgtacgtttgcgagctttgagc
agtgagcatggggtgacgatgttcatgacattgctctccgcgttcaatctgttgctcgca
cgctactctggcactcctgacatctgtgtcgggaccccgattgcaggtcgtcatcatcga
gaagttgagccgatgatcggactgttcgtcaacaccttggtgatccgaaccgacctgtcg
gagaatctgacgtttgccgaactgctcagccgcgtgcgggagacggcgctcaacgcattc
gcacatcaggatgttccgttcgaaaaattggtggaagttctagtgccgacgcgcgacctg
agcagaacaccgttgtttcaggtcatgttcgacctgcaagaggacatccttacaaaaatc
gaactgcccgatctcgccttgaccccgatcgagtttgacagcgagcatgccaaatttgat
ctaacgcttgcgatggtcgatcgcgaaagacagcttagcggcagtttcgaatacaatgct
gaccttttcgaatcggcgaccatcaaacggatgctcgtccattttgagcagttgctctgc
tcgatcaccgagcggtctaccgagcggatctccgctctttcgatgctcacctcgaacgaa
agaagcaccttgagcgcgtatgggagtggcgtaaaacgagcaatccctcagcacctgtgc
gttcatcagctatttgaagcacaggccgaaaaaacacctgactcgaaagcgatcgaatgg
aagtctggttcgctcagctacaaagaactgaacagaagagccaatcagcttgcacatgcg
ctgatcagagcgggcgttcgagtcgatcagcctgtcggtctatgcgttgcgcgctctccc
gagatgatcatcggcatgctggggatcatgaaagctggcggcgcctatctgccgctcgat
cctgcctatcccgcgcaacggatcacctacatgcttgaagatgcggatgcggacgtgttg
ctcacacagtcaggttgcatccccgcgaatgtgcagggacgaacggtgtttctgctcgat
gcggatcacgatcgattcgatcaagaatgcgaggagaatccagctacagatgttcgctct
gaccatctgtgctacatcatctatacatctggttcgacaggggctcccaaaggtgtggag
attgaacatcgcaacgtggtcaatcataaccttgcaatcgctgaggaatactcgttgcag
cctcatgaccgtgtcctgcaattttcctcgatctcctttgacatcgcagtcgaagagatc
ttcccgactttggtgacaggggggacgctttacattcgtgatgaagagatgctcaccaca
gcagaacgcttcttgcgtgagatcgatgagagaaagttgagcgtcctgaacttgccgacc
gccttttggtcaagctggacgcatgagcttgcagaacttggtgcaaagcttcccgagtcg
cttcgactgatgatcgtcggcggggaaaaagcatctcctgaagcgctgaccacctggcag
cggatcgcacccgaaatcgattggatcaacgcttatggcccaaccgaaacgactgtcacc
gcaaccttatttcgatccaaaggcagttcgactaggctcggctccattccgatcggcaga
ccgattgcaaatctagaagcgcacattttggatgcacatcttcaacctgttccaatcgga
gtggttggcgaattgtatttgagcggcgcaggtgtcgcacgcggctatcgcgatcgccct
gagctgacagcttccgtctttcttaacagtcccttccacgaagagggaagcgcacgcctc
tataagacaggagatctcgttcgctggctcagggacggtcaattggagtatgtcggaaga
gtggatgatcaagtcaaaatccgcggatttcggattgaggctggggagatcgaatcatgc
cttgaacaactgccgaccattcaagaggcgatcgtacttcccgtggaggagatcccgggc
aacccacgcctgatcgcctacttggtcacatcagatcgattcgatgagcaagaggtcgtt
gcgagccttaaggcatcactgcccgattacatgattccgtccgcgtgggtcacgctcgac
aaatttccgctgttgccaaacggaaaggtggatcgacgtgcacttgcaagcatccaatcg
acagctccagaccggttgacagaagttgttccccgaaccgagatggaacagcaattagct
tccgtttgggaaaaagtattgcggcgcgactcagtcggaattcatcagaactactttgaa
cttggcggcgattcgattctgagcatccagctcgcctctcgcgcagctgctcagggcatt
catctgtcgcccaaagatctctttcaacatccgacgatcgctcaacttgctcaggtcgcc
aagtgggcaaatgagaaggggactgatgcggaggaggaaccgactgctggccccgctccg
cttacgccaattcaacgctggttcttcgagctgcaccatgagtcgccacaccaatggaac
atgccgctgctggtagatctaaaagtcccactcgatctgcaggtgctgaaggaatctctg
cgagcgctcttcttgcatcatgatgcattgcgcatgcgcatcgtccaaacggaacgcggt
tgggagcaacagtttgacgagtcgatcggcgacgtgcccttcgaacgcctcgatctcacc
aatctctcagcggatgaggaagaagcggtgtggagagcagaagtggtgaagtggcaggaa
agcttgaatctgtttaccggcccgatcgcacgatttgtctacttggacagaggggaaaac
agatcgcatcgccttttctgcttggttcatcacctcgctgtcgacggagtctcttggcgg
atcttgctcgaagacctcgagcgcatctatgagcaattgttgcacggtgaagcggttcgg
ctgcttagaaaaacgacgtctgtgcaacggtgggcacgagtcttagcgcaacgtgcacag
gaagtggagatggaaaaggagctgacctattggctggatcaaaacgttgcagccgatcca
ctgcctgtagatgattcagctgggcgcaacacgtactcgtcactgcgtcgcaaacgaatg
ttcctcgatccagcaagcactcgcgcattgttgcaggaagcgcctcgagcgtttcggacc
agtgtgcaagacttgttggtaaccgctttggctcaaacgattgctgactggaccaaaggg
gagcacgtctcgcttgagctggagggacatgggcgcgaagagctgttcgaacatgcaaac
ctttcgcgcactgtcggctggttcaccgccacctatccgatccacctccatcttcagaac
cctgatgatcctgccgattcgctaaagcgggtcaaggaacagcttcgctcagttccacgc
ggaggtgtcggatatggtctgctccggttcatcggccgggaagaggggagaagcgctttg
cgcaaggccccacagccgcaagtgttattcaactatcatgggcagacagacatgcagttc
gactcttccaatctttttgcactttcagctgaggaagtggtggcgtcccacggcgcggac
aacctgaggagccatctgttggagatcaacggagcgattgtggatcaccgtctgcaactc
gattgggagtacagcgatcagttccattcggccgatacgatcgagctgctggtgaactcg
ttctacgaccatctgcaaaaattgatccaactctgcttctctccagaaggtcgagggcga
acaccctccgactatccgaacgctgaacttgatcaggaaaggctcgatcgcttcttgtca
caacttgagtcacgtggattccccctcgaaaacatcgaggatctttatccgctatccccg
atgcagcaaggaatgctctatcattccaacctcgtcgaagaaaaggggatgtacctcgtg
cagatgacgctacatctgcgcgggaacttaaaagttgatgtgttggaacgcgcttggcaa
tgggtggttgatcgtcacacgatcctccgcaccagctttcattggcaatcgcttcaggta
ccacttcaagttgtacatcaacaggttccaatcaccattaggagcttgcaggaagatgaa
catcaacaggttgtacaacagtttctggacgaagagcgcacagtcggattcgacctttcg
agtgcgcctctctgccgcttgactttggccgagattgacagcgagcaatctaaactgatc
ttcacttcccaccatctggtttcagatggatggtctttgcctttgatttttcaagagctc
tttgccgcgtatgtagctttcgatcaggagcaactgccgcagcaaccaaccgcgctacct
tttgttcgctatatcgcttggttacaacagcaagagttgcagtctgctgagaatttctgg
cgcggctatcttgacggattcagcacacctttgcgtttgggcattcgcaagcgagggacg
gaacaaacgttgccttcctcgctacctcaagaacaacatgccgccttatccacctctgtg
accgaacagcttgtgcgcatgtccaaacaacagcagcttaccctcaacacgatcgtacaa
ggtgcttggtcgatcctgttgagccgatacagtggaaacgatgatgttttgtttggtgcc
acctttgctggtcgacctgccgatctgctcggatctgacgagatggtcggtctcttcatc
ggcacgttgccgatccgggttcagatcgaatcgacacaagctgtgcttccctacctacgg
gctctacaacaaaggcagtctgaggtgcgcgaatatgagtatactccgctggtcgacatt
caaaagtggagcgaagtttctcacggacaagctttattcgatacgattttcgtcttcgaa
aattacccgatggatcggtcgctgaccgaaaatgtcggaggtctgttggttgaagagatc
atgtcagaagagtggaacaactacccgctcacactgactgttgtacctggtagcaaactg
atgctgaaagccatgtacgatcaaagtttgtatgacgatcgagacatcgaacggctgttg
gtgcacttgagcacgctgatcgaacagatcgtctctcaacctgagcaaacgatcggaaag
atgccgatgctcacagcggaagaggtcaaccaacagctggtcgaatggaatgatcgcagt
tggatgtccacctcggacctgtcgatcttgcgtttgattgaggagcaggcggagcgaacg
cctgaccgcactgcgatccagttcggtcaagagcggctgacctaccgcgaagtcactcag
cgtgtcgacgcccgtgctcaacagctgcgcgcgctgggtgtcacgcgtgatgcgctagtc
gggctctacctgaaccgctcgcacgaatgggtcatctccatcctcgccatctggaaagcg
ggaggcgcctatgtaccgctcgaccccgcacatccggtcgaacgcgtgacacggtgcctg
caggatgcacagccggccgtgctgctcaccgagagcaaactggtcgaaccttggatgaac
gaaatgaatcatctgctctgcgtcgattcatctgctgaattgcgcgcaaatgaccaacct
gtttgggaggcgatcaagtctgagcaacccgcctatgtgatctacacttcaggttctacc
ggcgtgcccaaaggggtgcaaatcgagcatcgctcgttgaccgattttctgttgacgatg
catcaacgcctgtcgttctctgagcgggaagtgctggtctccgtgacgacgatctccttt
gacatctcgattcttgagctgttcttgccgctgatctccggcgctcaagtggtcatcgca
gaagcggaagtggcggccgatgggaaacgattgggacagctcttagaagcggcgcaggcg
accgttcttcaagcgacccctgcgacttggtatttgttgatccacgctggttggctaggg
aagcacgacctacgcgccctctgtggcggggagaacctgcctcgcgatctggccgacgac
ctgctcgcgcgcgtcggagaagtgtggaacctgtacgggccgaccgaagcgaccgtctgg
gcgacagccgggaaggtggcgctctccgagccagtgtcggtcggtcgccctctggagcat
gtggagacctatgtgttggacgtcagcctgcaaccgttgccagtaggtgtcgtcggtgag
ctatatctgggcggttcctgcttggcaaccggctaccgaaacgctccggagttgacagca
aacgcgttcattccgcatccattcgcatccgagccagcatcccgcctctacaagacgggc
gacttggcacgctacctgcctgacggatcgcttgagattctcgggcgcaccgatcatcag
gtcaaagtgcgcggcttccgcatcgaactgggcgagattgaggaagtgctgttgcaacac
cccgaggtgcaccgagcggtggtcgtcgtgcaggatgcggcagtgggggacaagcgcttg
atcgcctattttgtccaagcggctgatcagccttcggtcgagtcgggtgaactcagaaga
tttctcaaacagcgcttgcccgactatatggtgccctctgcgtttgtcagcctgactcag
cttccgctgacaccaaacggcaaagtcgatcgcaaagcactgccacagcctgctgaattc
gcgagcgccgagagggcctatgttgcggcgcgcaccgagacggagacgatgctgagccag
ctgtggtcaagcgtgttgcgcaacaagcgcatcggcatgcacgacaatttcttcgagctt
ggcggacactccctgctggcgacacaggcggtcgctttgatgcaggaaaagatggggatc
gatcttccgctccgcactctgtttgaacatccgacagtggccgagtttgccgcttggatc
gaagagcggacagcgacggggaatcactcgttcgctgtagtaccccaactgccgatcgct
cgaccgtccaagcttccgctctcgttcgcccagcagcgcctatggatgctcgaccagctg
ttgcccgaccgagcagcgtacaacatgccgtttgcggtgcggatggaaggtgcgctcgac
cttgccgcacttgagctttccttgcatgagatcatctgcagacatgagatcttgcgcaca
acttttgccgagcaagcgggagagccgatccaggtgattcacgcaccgcagcaagaaacc
ctgttggtgatcgacctgtccgatcgagcagatggcgagcggaaggaaagactcgaacag
ctcatcgccgaggaggagaagcgggcgttcgacctgcaggtcggccccttgttacgccag
aagctggtgcgcttaggcgaatttgagcacgttttattgatgaccttccatcacatcatc
ttcgatgcttggtcgatcgctctgtttgtcgaggaactggtctcgctctacgaagctgcg
cacgagcagactctggcacaactgcccaagatggagcttcaatatgcagactttacgctc
tggcagcgcgactggttgcaagcggacgtgatggaggagcagatccaatattggaaacag
cagtttcatggtgagattccgatcttgcaactggcgaccgacaggccacgtcctgccgtt
caaagcgcgcgtggggcggcggagcggttggtgctggatgaagaactgaccgcagcgctg
cgatcgttctcgcaggagcatgagctcacgctctacatgacactgctcggagcgttctac
atcctgctgtatcggtacactggccaagaggacctcgtcgtcggcacaccgatcgccggt
cgccgacacaggcatgcagaaaagctggtcggtctgttcgtgaacacgcttccgctccgg
ctcgacctggcgggagcgccgactggtgaagaggtgtttgagcgcgtgcgccagatgatg
ctcggtgcctacagccatcaggacgttccctttgagcggctggtcgaggagttgcaaccg
acgcgagacatgagccggagccctctgttccaagtgatgttcggcctgcaaagcacgcag
ttgaccgagcaaaagctcaccggattgaccttgaacctgatcgacaaggaaacgccgttc
gccaagttcgacctgaacctagtgctgctcgaagaaggagggacggtgagcggctggtgg
gagtataacgccgatctgttcgatcgccagaccatccagcggatgatgctgcactaccaa
cagttgttgcgttcgcttctagaaggatcgacctcccaacctgagcaagcgatcggaaag
ctgccaatgctcacagtggaagaggtcaaccaacagctggtcgaatggaataatcgcagt
tggatgtccaactcggacctgtcggtcctgcacttgattgaggaacaggcggagcgaacg
cctgaccgcactgcgatccagttcggtcaagagcggctgacctaccgcgaagtaactcag
cgcgttgccgctcgtgctcaacagctgcgcgcgctgggtgtcacgcgtgatgcgctggtc
gggctctacctgaaccgctcgcacgaatgggtcatctccatcctcgccatctggaaagcg
ggaggcgcctatgtaccgctcgaccccgcacatccggtcgaacgcgtgactcgttgcttg
caggatgcacagccggccgtactgctcaccgagagcaagctggtcgaaccttggatgaac
gaaatgaaacatctgctctgcgtcgattcagctgttgaagtgcgcgcaaatgaccaacct
gtttgggaggcgatcaagtctgagcaacccgcctatgtgatctacacttcaggttctacc
ggcgtgcccaaaggggtacagatcgagcatcgctcgttgaccgattttctgttgacgata
cagcaacgtctgtcgttctctgagcgggaagtgctggtctccgtgacgacgatctccttt
gacatctcgattcttgagctgttcttgccgctgatctccggcgctcaagtggtcatcgca
gaagcggaagtggcggccgatgggaaacgattgggacagctcttagaagcggcgcaggcg
accgttcttcaagcgacccctgcgacttggtatttgttgatccacgctggttggctaggg
aagcacgacctacgcgccctctgtggcggggagaacctgcctcgcgatctggccgacgac
ctgctcacgcgcgtcggagaagtgtggaacctgtacgggccgaccgaagcgaccgtctgg
gcgacagccgggaaggtggcgctctccgagccagtgtcggtcggtcgtcctctggagcat
gtggaaacctatgtgttggacgccagcctgcagccgttgcctgtaggtgctgtcggtgag
ctttatctgggcggttcctgcttggcgaccggctaccgaaacgccgcggaattgacagcg
aaagcgttccttccgcatcctttcgcatccgggccagcatcccgcctctacaagacgggc
gacttagcacgctacctgcctgacggatcgcttgaaattctcgggcgtatcgatcatcag
gtcaaagtgcgcggcttccgcatcgaactgggcgagattgaggaagtgctgtcgcaacac
cccgaggtgcaccgagcggtggtcgtcgtgcaggatgcggaagtgggggacaagcggttg
atcgcctattttgtccaaacggctgatcagccttcggtcgagtcgggtgaactccgaaga
tttctcaaacagcgcttgcccgactatatggtgccctctgcgtttgtcagcctgactcag
cttccgctgacaccatccggcaaagtcgatcgcaaagcactaccacagcctgctgatttc
gtgagcgccgagagggcctatgttgcgccgcgcacggagacggagacgatgctgacccag
ttgtggtcaagcgtgttgcgcgtcgatcgcatcggcatgcacgacaatttcttcgagcta
ggcggacactctttgctggcgacacaggcggtcgctttgatgcaggagaagatgaggatc
gatcttccgctccgcgccctgtttgaacatccgacggtggccgagtttgccgcttggatc
gaagagcggacagcgacgggggacctctcgttcgctgtgctacctcaactgccgatcgct
cgaccgtccaagcttccgctctcgttcgcccaacagcgcctgtggatgctcgaccagctg
ttgcctgaccgagcagcgtacaacatgccgtttgcggtgcggatggaaggtgcgctcgac
cttgctgcacttgagctttccttgcatgagatcatctgcagacatgagatcttgcgcaca
acttttgccgagcaagcgggagagccgatccaagtgatccacgcaccgcagccagaaacc
ctggcggtgatcgacctgtccgatcgagcagatggcgagcggaaggaaagactcgaacag
ctcatcaccgaggaggagaagcgagcgttcgacctgcaggtcggccccttgttacgccgg
acgctggtgcgcatgggcgaagaggagcacgttttattgatgaccttccatcacatcatc
ttcgatgcttggtcgatcgctctgtttgtcgaggaactggtctcgctctacgaggctgcg
cacgagcagactctggcacaactgcccaagatggagcttcaatatgcagactttacgctc
tggcagcgcgactggttgcaagcggacgtgatggaggagcagatccaatattggaaacag
cagtttcatggtgagattccgatcttgcaactggcgaccgacagaccacgtcctgccatt
caaagcgcgcgtggggcggcggagcggttggtgctggatgaagagctgaccgcagcgctt
cgctcgttctcccacgagcatgagctcacgctcttcatgacactactcggagcgttctac
atcctgctgtatcggtacagcggtcaagaggacctcgtgatcggcacaccgattgccggc
cgccggcacaggcatgcagaaaagctgatcggcctgttcgtgaacacgcttccgctccgg
ctcgacctgtcgggagcgccgaccggcgcagagttgttcgagcgcgtgcgccagatgatg
ctcggtgcctacagccatcaggacgtgccctttgagagactggtcgaggagttgcaaccg
acacgagacatgagccggagcccgctgttccaagtgatgttcggtttgcaaagcacgcag
ctgaccgagcagaaactctccggattgaacttgaacttgatcgacaaggaaacgcctttt
gcgaagttcgacctgaacctagtgctgctcgaagaaggaggaaaggtgagcggctggtgg
gagtataacgccgatctgttcgatcgcacgaccatccagcggatgatgcagcactacgaa
cagttgttgcgttcgattctgaacggacctgtgtctgaaatttctcgcctgccgctcttg
gcagcatcagaacgagcacgattgctacaactgccgcacccagcagagatgcgtcgctca
tccgaacagaccctgcatcagcagtttgaagcgatggtggaacggacgcccgaccgcgtt
gcgctcgtcttcgagtcgaactccctgacctatcgggagctgaacgagcgagccaaccgg
gtcgccgcccatctgctgtcgctcggggtacagcccaacacgcttgtcggcctctgcacc
gagcgatcgctggagctggtcatcggcctgctcgccatcctcaaggcaggcggtgcatac
gtcccgctcgatcctgcctatccggccgatcgactcgcgttcctgcttcaggatgccagc
ctttcgatcctgctgacgcaacagcatctgcgcaatacgcttcctgctcatcgcgcacag
gtcgtctgtctggatgatcacgctctgttcgcctccgcgagcgctgacaatctgcacagc
gccgcgacggcagaaagcatcgcctatgtgatctacacgtccggatcgaccggacagccc
aaaggcgtgccgattccgcatgcgaacgtcatccgcctgttcacttcgactgcgcactgg
ttcccgtttgcagaagacgatgtctggacgctcttccactccttctcgttcgacttctcg
gtctgggagctgtggggcgcgctcttgcacggagggaaagcggtcatcgtgccctactgg
atcagccgctcgcccgaagcgttcctgcacctgctcgcctccgagcgggtgacggtgctc
aaccaaacgccttccgccttccgtcagctcatgcaagcggaagcggcacaatcggaccgg
caagcgctgtccctgcgctgggtgatcttcggcggcgaagcgctcgatctgcccgcgctg
cgcccttggttcgatcggcacggcgaccagagcccgcagttgatcaacatgtatggcata
accgagacgaccgtccacgtcacctaccgccccttgaagcgggaagatgcgctgcgcgca
aacagcgtgatcggacatccgatccccgaccttgaggtgtacgtgcttgacccgcatctg
gagccggtgccaatcggcgtagcgggtgagctatatgtgagcggggcaggggtagcccct
ggctacctccaccggccggagctgaccgccgagcggttcctgcaccatccgttccgcgcc
gaagcgcaagctcgcctctacaagacgggcgatctggcgcggcgcctgccgagcggagag
ttggaatatctcggacggatcgaccaccaagtgaagatcagagggtttcgcatcgaactg
ggggagatcgaatcgatgatcggccaccacccgggcgtgcgcgaaacggccgtgctggtg
cgcgaagatcgggcggacgacaagcagatcgtcgcctatgtggtcacccatgtcggtacc
gaactgcagccgagcgatctactctctcattgcaaagagcgcttgccagactacatggtt
ccagccgccttcgtgctgcttgacgctctgccgctcacacacaacggcaagctggatcgc
aatgctttgcccgcaccgattgggcagcagaaagatcgcacaattcgctcgcagccggag
agtgctaccgaaatcgcgatttctgaaatttggaaggaagtgctcggagtcgaacagatc
gatcgcgaagacaatttctttgaccttggcggacattcgctgcgagctactcaagcggtc
tcgagaatcggtgcaacactcgggatcaaactatcgcttcgcaccttgttcgaaactcca
actctacggcttctggccgaagaggttcaacaccagcagatgaaggagatgccagtttca
acccaagcgatctgtcagcagtcccggatcggggagattccactctcctttgcacaggag
cgactatgggttctcgatcgtctgatgccaggcaacaccgcatacaacatcccgtttgca
ctctcgatgatcggcgagctggatgatgaggcactcgagtggagtatcaacgagatcatt
aagcggcatgagattctgcgcaccaccttgcatcaggtcgaaagcagcgcagttcaacgc
atcgcaaaaccagattggcaacgcttgactcgcaccgacctgcgcagcctctcgtccgcc
gattgggaacgggaagtgagtgcgcgtcttcaagcggagacagagcgagtgttcgatctg
accgcaggaccgttgctatacgtcgagctcctgcaacgcgcatctgacgatcatgcgctt
gtgatcaacatgcaccatatcatctcagacggctggtcgatcggtctgctcgtgcaggag
ataggcgcgctgtatacagcctatgtagaaggtcagacgtctccgctcgccgacttgtcg
attcagtacgcagattatgcgatctggcagcgcgaatggctcgctggacagcggtgggac
gagcagttgtcctactggaagacacagctcggcgggtcactaccagctctgcaattgcca
accgatcatccgcgtccacctgtacaatcctatcgcggtgcttcctttgcttttgcgatc
gacaaagtggttgtcgaagcgcttgaagcgatcggcaaaagtcacagtgcgacgctgttt
atgaccttgttcagcgttttccaaacgctgttgtaccgctatacaggccaggaggacctc
gttgtaggcactccgatcgccgggcgtcagcagcaagaaacggaaggattgatcggattt
tttgtcaacacgctggtcatgcgcaccgacctgtcagcgcggcagacatttgtcgaactg
ctagctcaagtccgccaaacggcgctcgacgcttacacgcatcaggatattccgttcgaa
aaactggtagccgagctccagccgatccgcgatcgaagcagatccccgctgtttcaagcg
atgttcgcactgcaaagcgcatcgcaggcatgtttatcacttccagggcttgccatccag
cagatcgaaggagcgacgacgacagccaaattcgatctgtccgtaaccttcgaagagagt
gaacaagggctgaacggacatctcgaatacagcaccgatcttttcgaggccagtacgatt
gctcgcatggcagaccatctggtgacgctgatgaacagcgtgattgaaaatccaaacaca
ccggtgtctgaactgcagatggtaacagaagcggagaagaggctgtttagcgaatggaat
ggtgaactgccatcaccagcagatcaatgtgtgcaccgcctgtttgaatcacaggtgatc
cgcacgccagatcgcatcgcggtcgaacatgaagggaatgaactcagttaccgtgagctc
aatgcgcgcgccaaccaattggctcgacatctgcaggcgctcggtgttgggccggagatg
cccgtcaccttctgcctggatcggtcactcgatctggtgatcgcccaacttgccattctc
aaagcgggcggagcatacgtgccgatcgatccgaacaatccgccggagcgaactgcgttc
atcctgcaggatacgaatgcgttggtgatggttgcacactcccatctaatccgagagctg
cccaacctgccggctcaactcgtctgtctcgatcaagatgaggatgtgctgtcagcctac
tctggcgaagatgtgagcagcgatgtgcgtccagatcatcttgcttatctgatctacaca
tctggatcgactggccggccgaaagctgtcgccgtcgaacatcgaaacgtgctctccact
ttgctcatcgcccaagagcaattcgtgttccgagaaagcgatgtgatcatgtggacttca
tccgctgcgtttgacatttcgcaattcgaactgtggagcactctgtttgttgggggtcgc
atcctcttgctctctcgggatcatatcttaaacattgaccgcatgatcgtggatctgaca
cgtgccaccgtggtaaatttcgtaccaaacttgatgagacgcgtcatcgaagctacgaaa
tctgcgattcaagaggggacgcgatttgacaacttgcgctacctgttcatcggcggagac
gcagtccccccacagatgttagtagagacgaatcaaacctttccgcgcacagacacgtat
gtgctctatggtccgacggaggcttcaatcttcgccaccagtcatctggccaagcgcggg
gaagagggggatcggattttgatcggcaagcgttgcttgaacgctcagctctacatctgt
gatccgttcgaccaagaggtcccgctcggagtgccgggtgaacttcagatcggcggactt
ggggttgctcgagaatacttcggtcgagaggaattgacagcagaaaaattcgttacggtc
gatggacaaagacgctacaagacgggcgaccttgtgcgctacctaccagacgggtcgatc
gagtttctcggacgcatcgacggacaggtcaagattcgcgggttccgtatcgagatcggc
gagatcgaagcggcattgactcaacagcctgacattgtggatgccgttgtgcaagtacat
gagaccgcagcgggggagaagcggttgatcgcctatgtggcaagatcagaggaaggaaag
ttggatgtgcgctccttgcgtcacgaattgcagaaacgactgcccgattatatgattcct
gctcggttcatccaactggaagcactgcctttgaacccgaatggaaaagtggaccgaaaa
gctctgcagacacttgaatggcccgccatggatagcgaggattttgcgcagccaagcact
ccgaccgaaacaaaagtggccgccatcgtcgccaacttgctcagcctgcagcagatcggc
gtgcatgacaacttctttgagctcggtggccactcgctgctcgccatgcaggcgatcgcg
gagattcgcgccgagctgaaggtagaagtgccgttgtctgcgctgtttgaagcaccgagc
atagcggagctgtccgccatgatcgacattttgctcaacgagactccgcagcaagaatcg
agcatcaagcgagcttctcgctccgcacatgcgcggagacgatag

DBGET integrated database retrieval system