KEGG   Tumebacillus algifaecis: CIG75_12485Help
Entry
CIG75_12485       CDS       T04994                                 

Definition
(GenBank) hypothetical protein
  KO
K12132  eukaryotic-like serine/threonine-protein kinase [EC:2.7.11.1]
Organism
tab  Tumebacillus algifaecis
Brite
KEGG Orthology (KO) [BR:tab00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:tab01001]
    CIG75_12485
Enzymes [BR:tab01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     CIG75_12485
Protein kinases [BR:tab01001]
 Serine/threonine kinases: Other
  Bacterial family
   CIG75_12485
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pkinase PASTA Pkinase_Tyr APH Kdo Kinase-like RIO1 Haspin_kinase TM_PBP2_N
Motif
Other DBs
NCBI-ProteinID: ASS75720
UniProt: A0A223D2A6
LinkDB All DBs
Position
complement(2962356..2964332)
Genome map
AA seq 658 aa AA seqDB search
MIGRKLGDRYEVIERIGGGGMAVVYRALDTLLNRNVSIKVLHAQFSNDEDFVRRFRREAQ
AAASLSHPNVVNIYDVGRGGDEYYIVMEFVDGLTLKEVIQDRAPLPVQEAIDISKQICSA
LGHAHENNIVHRDIKPHNILIGKDGRVKVTDFGIARAITSNTITQDGSVLGSVHYFSPEQ
ARGGITDVKSDIYSLGVVLYEMMTGELPFSGETPISVALKHLQDHFVEPRQINPSLPQSV
ENIILKSLAKDPSVRYQSAREMSRDLEKALLYPNVAKFVAPLFDEQSTIQLPAVGLRTAK
TASPGHTSPTEDSVSAPEDGKLPVTDGNEGGKKKKNFWRPVIWLFAVFLLLGVGAVTAYT
LVTNYMGEKDVTMPEVVGKSYDEAVKALLNAGLDINNINKEEESSDEHPAGTVISQDQYG
GKTIKANREVTLTVSKGPERMQMPAITDLSKDKALEKLKQAGINTSNVTFEEREEKETAV
GTVLSQNPASGVTIDKETKIVLTVAKAIEKAKVPQVSGLKLDEAKAKLTAAGFKIGEVIS
QHSNDVGAGKVIGTSPSYTPGTELAKGETISLVVSQGVKEEPKKKTYDVQVPVEEDQKKK
VKIVRSDAQGSAVVVDETIEATKSFHVEVIVKPGEIASIKVYIDGKEEKTIPIPYGEQ
NT seq 1977 nt NT seq  +upstreamnt  +downstreamnt
ttgatcggacgaaagcttggcgatcgttatgaagtgatcgaacgaatcggcggcgggggc
atggcagtggtctaccgcgcactggataccttgctcaaccgcaacgtttcgatcaaagtt
ctgcatgctcaattctcgaacgatgaagattttgtgcgtcgttttcgccgtgaagcgcag
gcggccgcatcgctctcccatccgaacgtcgtcaacatctatgacgtggggcggggtgga
gatgagtattatatcgtcatggagtttgtagacggattgacgctgaaagaagtgatccaa
gaccgagcaccgctcccggtacaggaagcgatcgacatctccaaacagatttgttctgcg
ttgggacatgcgcatgaaaataatatcgtccaccgtgacatcaagccccataacattctg
atcggcaaagatggacgcgtcaaagtgaccgactttgggatcgcacgggcgatcacttcc
aacacgatcacccaggatggttctgtgctagggtctgtgcactacttctcgccggagcag
gcaagaggtgggatcaccgatgtaaaatcggacatctactcgcttggcgtcgtactctat
gagatgatgaccggcgaattgccattttccggggaaacgccgatctcggtggcgctcaag
catctgcaggaccactttgtggagccgcgtcagatcaatccctcgttgccacagtctgtg
gaaaacatcatcctaaaatcattggcgaaagatccgagcgtgcgctaccagagcgctcgt
gaaatgtcgcgcgacttggaaaaagcgttgctctacccgaacgttgccaagtttgtcgca
ccgctttttgatgagcaaagcaccattcagctgccagcggtcggtctacgcactgcgaaa
acggcgtcgcctggtcacacgtcgccaacggaagacagcgtttctgcacctgaagatggg
aaactgcctgtcaccgatggcaacgagggcggtaagaagaaaaagaacttctggcgcccg
gtcatctggctgttcgcagtgtttcttctgctgggggtgggggcggtcaccgcttacacg
ctcgtcaccaattacatgggagaaaaagatgtgacgatgccggaagtcgtcgggaaatcg
tacgacgaggcggtgaaagccttgctcaatgcggggcttgatattaataacatcaacaaa
gaagaggaatctagcgacgaacacccagccggaacggtcatcagccaagaccaatatggt
ggcaaaacgatcaaggccaaccgcgaagtgacgttgaccgtttcgaaaggcccggaacgg
atgcaaatgcctgcgatcaccgatcttagcaaagacaaggcgctggaaaagttaaaacag
gcggggatcaacaccagtaacgtcactttcgaagagcgtgaagagaaagagacggcggtg
ggtaccgtattgtcgcaaaatccagcttctggagtgacgatcgacaaagagacgaagatc
gtgctgaccgttgccaaagcgatcgaaaaagcgaaagtgccacaggtatccggattgaaa
ttggacgaagccaaagcgaaactgaccgcagccggctttaaaatcggggaagtgatctcg
caacactccaatgatgtaggagcgggcaaagtgatcggtacctctccatcctatacgccg
ggcacagagctcgcgaagggcgagacgatctctcttgtcgtctcacagggcgtgaaagag
gaaccgaaaaagaaaacgtacgatgtgcaggtacctgtggaagaggaccaaaagaaaaaa
gttaagatcgtccgcagcgacgcgcaaggcagcgcggtggtggtcgatgagacgattgaa
gcgactaagtccttccatgtggaagtgatcgtcaaaccaggggagatcgcttccatcaaa
gtgtatatcgacggcaaggaagaaaagacgattcctatcccctatggtgagcagtga

DBGET integrated database retrieval system