KEGG   Tumebacillus algifaecis: CIG75_17945Help
Entry
CIG75_17945       CDS       T04994                                 

Definition
(GenBank) alanine racemase
  KO
K01775  alanine racemase [EC:5.1.1.1]
Organism
tab  Tumebacillus algifaecis
Pathway
tab00473  D-Alanine metabolism
tab01100  Metabolic pathways
tab01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:tab00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    CIG75_17945
 09160 Human Diseases
  09175 Drug resistance: Antimicrobial
   01502 Vancomycin resistance
    CIG75_17945
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:tab01011]
    CIG75_17945
Enzymes [BR:tab01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.1  Acting on amino acids and derivatives
    5.1.1.1  alanine racemase
     CIG75_17945
Peptidoglycan biosynthesis and degradation proteins [BR:tab01011]
 Precursor biosynthesis
  Racemase
   CIG75_17945
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ala_racemase_N Ala_racemase_C Rib Lamprin DUF4813
Motif
Other DBs
NCBI-ProteinID: ASS76666
UniProt: A0A223D5H8
LinkDB All DBs
Position
complement(4045794..4046954)
Genome map
AA seq 386 aa AA seqDB search
MDGKYVRQTWAEINLDAIGHNVRVSKQILPPGTGVMAVVKANAYGHGASQVAEIALQNGA
EYLGVAAADEAIELREAGITAPILILGYTPTNFAKDIVTYDLTQTVFNTDLLLALDRAAR
EQNTKAKIHLKVDTGMGRLGFTGLDEVVGFAKRAADMPGINLEGIFTHFATADELDSSYA
EEQISRFAAVLERLQLAGLKIPLQHISNSAGIIQYTNCPGNMVRLGISMYGYYPSQEVPK
DVELQPALRFVSHVVHLKEVPAGTKISYGATFETKAPSKIATIPVGYADGYSRLLSNKGE
ALIRGMRVPVVGRVCMDQLMLDVTEVEAVETGDEVVLYGRQGNSEIPLDEVADKIGTITY
EVLCVLGRRVPRKFQHLGKTVEVQTM
NT seq 1161 nt NT seq  +upstreamnt  +downstreamnt
gtggatgggaagtatgtacgccaaacttgggcggagatcaacctcgatgccatcggacac
aatgtccgcgtgtcgaaacaaattctgcctccgggcaccggagtgatggcggtggtcaaa
gcgaatgcctatggtcacggagcgagccaagtggcggagatcgccctgcaaaacggagcg
gaataccttggcgtagcagcggcagacgaagcgatcgagctacgcgaggcggggattaca
gccccgattttgatcttagggtacaccccgaccaactttgcgaaagacatcgtcacctac
gatctgacgcagacagtgttcaacaccgatctgctcctcgccttggatcgggcggcgcgc
gagcagaacaccaaggcaaagatccacctcaaagtcgatacggggatggggcggcttggt
tttaccggccttgacgaggtggtgggctttgccaaacgggcagccgacatgccgggaatc
aacctcgaaggcatcttcactcattttgcaactgcggacgagctggactcctcctatgcg
gaagagcagatcagccgctttgccgctgtgctggaacgcttgcaacttgcaggtctgaag
atcccgcttcagcatatatcgaatagtgcgggcatcatccaatatacgaattgccctggc
aacatggttcgactgggcatctcgatgtacggctattacccgtcacaagaagtgcctaaa
gatgtggaactccaaccagccctgcgctttgtctcacatgtcgtgcacctcaaagaggtg
ccggcaggaaccaagatttcttatggggcgaccttcgaaaccaaagcgccatcgaagatt
gccaccatccccgtcggctacgcggacggttattcgcgcctgctgtccaacaaaggggaa
gcgttgatccgtggcatgcgcgttccggtggttggccgtgtctgtatggatcagctcatg
ctcgacgtgacggaggtcgaagcggtcgagacgggtgatgaggtcgtgctctacggacgg
cagggaaattcggaaattccgctcgatgaagtggccgacaaaattggcacgatcacctat
gaagtgctgtgtgtgctcgggcgccgagtgccgcgcaaatttcaacatttaggtaagact
gtagaggttcaaacgatgtag

DBGET integrated database retrieval system