KEGG   Thermoplasma acidophilum: Ta0809
Entry
Ta0809            CDS       T00037                                 

Definition
(GenBank) probable aldehyde dehydrogenase
  KO
K18128  D-glyceraldehyde dehydrogenase (NADP+) [EC:1.2.1.89]
Organism
tac  Thermoplasma acidophilum
Pathway
tac00030  Pentose phosphate pathway
tac01100  Metabolic pathways
tac01120  Microbial metabolism in diverse environments
tac01200  Carbon metabolism
Module
tac_M00309  Non-phosphorylative Entner-Doudoroff pathway, gluconate/galactonate => glycerate
Brite
KEGG Orthology (KO) [BR:tac00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    Ta0809
Enzymes [BR:tac01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.89  D-glyceraldehyde dehydrogenase (NADP+)
     Ta0809
SSDB
Motif
Pfam: Aldedh LuxC Terpene_syn_C_2 DUF2884
Other DBs
NCBI-ProteinID: CAC11938
UniProt: Q9HK01
LinkDB
Structure
PDB: 
5IZD 5J77 5M4X

Position
861266..862747
AA seq 493 aa
MDTKLYIDGQWVNSSSGKTVDKYSPVTGQVIGRFEAATRDDVDRAIDAAEDAFWAWNDLG
SVERSKIIYRAKELIEKNRAELENIIMEENGKPVKEAKEEVDGVIDQIQYYAEWARKLNG
EVVEGTSSHRKIFQYKVPYGIVVALTPWNFPAGMVARKLAPALLTGNTVVLKPSSDTPGS
AEWIVRKFVEAGVPKGVLNFITGRGSEIGDYIVEHKKVNLITMTGSTATGQRIMQKASAN
MAKLILELGGKAPFMVWKDADMDNALKTLLWAKYWNAGQSCIAAERLYVHEDIYDTFMSR
FVELSRKLALGDPKNADMGPLINKGALQATSEIVEEAKESGAKILFGGSQPSLSGPYRNG
YFFLPTIIGNADQKSKIFQEEIFAPVIGARKISSVEEMYDLANDSKYGLASYLFTKDPNI
IFEASERIRFGELYVNMPGPEASQGYHTGFRMTGQAGEGSKYGISEYLKLKNIYVDYSGK
PLHINTVRDDLFQ
NT seq 1482 nt   +upstreamnt  +downstreamnt
atggatacgaagttatacatagatggacagtgggttaattcttcttccggaaagactgtc
gacaagtacagcccggtgactggacaggtcatcggaaggtttgaggcggcgaccagagat
gatgttgacagggccatagatgctgcggaggatgcattctgggcctggaacgatcttggt
tcggtggagagatcgaagataatttacagggcaaaggaactgatagagaagaacagggcg
gaacttgagaacataataatggaggagaacggaaagccggtaaaggaggccaaggaggag
gtcgacggcgtcatagaccagatacagtactacgcggaatgggcgaggaagctcaacggc
gaggtcgtcgaaggaacgtcgtcccacaggaaaatattccagtacaaggttccttacggc
atagtcgttgcgctgacgccctggaatttcccggccggtatggttgcgaggaagctggct
cctgcgctgttgacaggaaacaccgttgttctgaagccgagcagcgatacgcccggaagc
gcagagtggatcgtgcgcaagttcgtcgaagccggcgtaccgaagggcgttttgaacttc
atcaccggaaggggatcagagattggcgattacatagtcgaacacaaaaaggtaaaccta
ataacgatgaccggttcaaccgcaaccggccagaggataatgcagaaagcatcagccaac
atggcaaagctcatactcgagctgggcggaaaggcgccgtttatggtgtggaaggacgca
gacatggacaatgcactgaagaccctgctgtgggcgaagtactggaacgcgggccagtct
tgcatagcggctgagcgcctctacgtgcacgaagacatctacgacacattcatgagcagg
ttcgtggaactgagcaggaagctcgcactgggcgatccgaagaacgctgacatgggcccg
cttataaacaaaggcgcgctccaggccacatccgagatcgttgaagaggcaaaggagagc
ggtgcaaagatactgttcggcggaagccagccaagcctcagcggaccgtacaggaacggc
tacttcttcctgccgaccataataggcaacgcagaccagaaatcgaagatattccaggag
gaaatattcgcaccagtcataggcgccaggaagatatccagcgttgaggaaatgtacgat
ctggccaacgattcaaagtacggcctggcatcgtacctgttcacgaaggacccgaacata
atattcgaggcttcagagaggataaggttcggcgaactttacgttaacatgcctggtccg
gaggcctcgcagggataccacacaggcttccgcatgaccggacaggcaggagaggggagc
aagtacggaatatccgaatacctgaagctgaagaacatctacgttgattactccggaaag
cccctgcacataaacaccgtgagggacgatctgtttcagtga

DBGET integrated database retrieval system