KEGG   Thermoplasma acidophilum: Ta1148Help
Entry
Ta1148            CDS       T00037                                 

Definition
(GenBank) DNA ligase related protein
  KO
K10747  DNA ligase 1 [EC:6.5.1.1 6.5.1.6 6.5.1.7]
Organism
tac  Thermoplasma acidophilum
Pathway
tac03030  DNA replication
tac03410  Base excision repair
tac03420  Nucleotide excision repair
tac03430  Mismatch repair
Brite
KEGG Orthology (KO) [BR:tac00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    Ta1148
   03410 Base excision repair
    Ta1148
   03420 Nucleotide excision repair
    Ta1148
   03430 Mismatch repair
    Ta1148
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:tac03032]
    Ta1148
   03400 DNA repair and recombination proteins [BR:tac03400]
    Ta1148
Enzymes [BR:tac01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     Ta1148
    6.5.1.6  DNA ligase (ATP or NAD+)
     Ta1148
    6.5.1.7  DNA ligase (ATP, ADP or GTP)
     Ta1148
DNA replication proteins [BR:tac03032]
 Eukaryotic Type
  DNA Replication Elongation Factors
   Other elongation factors
    Ta1148
 Prokaryotic Type
   Elongation factors (archaeal)
    Other elongation factors
     Ta1148
DNA repair and recombination proteins [BR:tac03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    Long Patch-BER factors
     Ta1148
   NER (nucleotide excision repair)
    Other NER factors
     Ta1148
   MMR (mismatch exicision repair)
    Other MMR factors
     Ta1148
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DNA_ligase_A_M DNA_ligase_A_N DNA_ligase_A_C mRNA_cap_enzyme DNA_ligase_OB_2
Motif
Other DBs
NCBI-ProteinID: CAC12273
UniProt: Q9HJ26
LinkDB All DBs
Position
1220048..1221814
Genome map
AA seq 588 aa AA seqDB search
MLFSVVADAFEKMESTTKRLELTDLLVNLLKEADDDLPLLIYLLEGKLGPDYLGIETQMS
DKLIIKALSVASNISEDEIAKEYAKAGDIGTIAKEIAEKRSLRSLVQEEMTVKYIHDTLM
KMARTTGSGSTKARVDAYMDLFLNSTPKEIMYITRIITGKLRIGISDATILDAIVKAFAD
EKYSEDIENAFNFHPDLGYIASELRKGNIDAILKLGPTPMIPFKVMLAERLRSVEEILEK
MGGRCAFEYKYDGMRTETHIERGKVRLFSRGNEETTNQFPDITKAASETFKVDSAILDGE
AVPYDPDTGELYPFQVISHRRGRKYDLDKVSSEIPITVFLFDIVYLNGRDLSKTPYTERR
KILESIFTESDSFRLAKRIESGDPAEVHRFFNSAIEDGCEGLVAKSTSPDSFYKAGARGW
LWIKLKRDYQAQLWDTLDLTVVGAFYGHGRRKGTYGALLLATYNDKNDTFETVCKLGSGF
SDDVLFSLPKKFEQYVSKEKPARVISNLEPDVWFYPAVVMEVIGAEITVSPIHTCAYGEI
EKDSGLSVRFPRFTGKWREDKKPEDSTTSREILEMYKEQKKTITEEKS
NT seq 1767 nt NT seq  +upstreamnt  +downstreamnt
atgttattttccgtagttgcagatgcctttgaaaagatggaaagcaccactaagcggctg
gaattgaccgatcttcttgttaacctgctaaaggaggcagatgacgatcttccccttctt
atttatctgctggaggggaagcttggcccggactacctgggcatcgagacgcagatgtca
gataagctcattataaaggccctgtcagttgcctcaaatataagtgaggatgaaatagcg
aaggaatacgcaaaagcaggcgatataggaacaatcgcgaaggagattgcggagaagagg
agccttaggtcactcgtgcaggaagagatgacggtgaaatacattcatgatacgctcatg
aagatggcacgaactacaggatcaggaagcacaaaggccagggtggatgcatacatggat
ctatttctcaacagcacgcccaaggagatcatgtacataactagaataatcaccggaaag
ctcaggatcggaatatcagatgcgacgatactggacgctattgtgaaggcctttgcagat
gaaaaatattcagaggacattgaaaatgccttcaactttcatccagatctcggttatatc
gcctcagagctccgcaagggcaatattgatgccatactaaaactgggcccaacaccgatg
attccctttaaggtcatgcttgcggaacgccttagatccgtagaagaaatcctggaaaag
atgggcggaaggtgtgcatttgaatacaagtacgatgggatgaggacggagacccatatc
gaaaggggaaaggtgaggcttttctcaagaggaaacgaagaaaccacgaaccagtttcca
gatataacgaaggctgcatccgagaccttcaaggtcgattcggcaatactcgacggagag
gctgtgccatatgatccggatactggggaactctatccattccaggtgatatcccatagg
agggggaggaagtatgatctcgataaggtatcatcagagatacccataacggtcttcctc
ttcgacatagtgtatctgaatggaagggatctatccaaaactccatataccgagaggaga
aagatactggaatcaatatttacggagagcgatagcttcaggcttgcgaagaggatagaa
tccggagatcctgctgaggttcaccggttcttcaacagcgcgatcgaggatggatgtgag
gggctggtggcaaagagtacatctcctgattcgttctacaaggccggagcccgtgggtgg
ctctggataaagctgaagagggattatcaggcacagctctgggatactctcgatctaacc
gtcgtgggcgccttttacggccatggaaggaggaagggaacctatggagctctgcttctt
gccacttacaacgacaagaacgatacttttgaaacggtctgcaagctgggatcaggattc
tccgacgacgttctgttttcgcttccgaagaagtttgagcagtatgtatctaaagaaaag
cctgcacgggttataagcaacctggaaccagacgtgtggttctatcctgctgttgtcatg
gaggtaataggggcagaaatcaccgtaagccccatacacacctgtgcctacggggaaata
gaaaaggactctggactttcagtgaggtttccaaggttcacaggaaaatggcgcgaggac
aagaaacctgaagattcaacaacatctagagaaatactcgaaatgtacaaggaacaaaaa
aagactataacggaggagaagagttaa

DBGET integrated database retrieval system