KEGG   Thermoplasma acidophilum: Ta1346Help
Entry
Ta1346            CDS       T00037                                 

Definition
(GenBank) multidrug-efflux transporter related protein
Organism
tac  Thermoplasma acidophilum
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MFS_1 MFS_3 LacY_symp
Motif
Other DBs
NCBI-ProteinID: CAC12467
UniProt: Q9HIJ3
LinkDB All DBs
Position
1395759..1396970
Genome map
AA seq 403 aa AA seqDB search
MIGGNAPAPYYRNRSLWGVSIAASVRSIGYGATWPFLAVYFNTYLHMSLLFVGLIFTLNS
GISIVFSLFAGYMAAAFGRKFTLVLGNVAGFILYLLLSIFSGKNVAIISTLFVLTAFSGS
LVFPSANSIVSDITSSMDREMGYAIYRIMANLGWAIGPLISAIIFSYGFGFIFLFVAIAN
AFATVIALIFVKTNTKFRSNRSGFLVKDYTLFFFSVPVFLLIMVSSQFSVTLPIYIVDDL
HIVIKNLAYFYAVNGIVVVVGQYPISRMMRGHSDLYGLIFGSVFYTIGYLMVSFSHSLFY
LIIDMIIITIGENFTSPNISTVASKIAPRDKVGRYMGFIGMINQLARTASPSVGTFILYS
LSSSPILVWPAIDGFGISAIILFLVFKIAFVDRSRASGRPVNI
NT seq 1212 nt NT seq  +upstreamnt  +downstreamnt
atgatcggtgggaatgcgccggcaccatactacaggaacaggtctctgtggggagttagc
attgcagcctcggtaagatccataggttacggtgcaacatggccgtttcttgccgtgtac
ttcaacacgtatcttcacatgagcctattgttcgttggccttatattcacgctgaactcc
ggcatttccatagtcttcagcctgtttgccggctacatggcagccgcattcggaaggaaa
ttcacactcgtgctgggaaacgtggccggttttatcctgtacttgctgctgtcgatcttt
tctggaaaaaacgtagcgatcatatcgacactcttcgtgctgacggcgttttccggatcg
ctagtcttcccctctgcaaactcaatagtttcagatataacctcgagcatggatcgtgaa
atgggatatgcaatctacaggataatggcaaaccttggctgggccataggccctctcata
agtgcaatcatattctcctatggtttcggcttcatatttctgttcgtggccatagccaac
gccttcgccaccgtgattgcccttatctttgtgaagacgaatacgaagttccgatcgaac
agatccggctttctggtcaaggattacacgcttttctttttcagcgtaccggttttcctg
ctgataatggtttcatcgcaattctccgttactttgccaatatacatagttgatgacctc
catattgtgataaagaacctggcctacttctatgctgtcaacggaatagtggttgtcgtg
ggccagtatcccatatccagaatgatgagggggcactctgacctttacggcctcatattc
ggatctgtcttctacaccatcgggtatcttatggtctcgttctcgcacagcctgttctat
ctcataatcgacatgatcattataaccataggcgagaactttacctcaccgaacataagc
actgtggcgtcgaaaatcgcacccagggacaaggttgggcgttatatggggttcataggc
atgataaaccagcttgccagaacggcatcgccgtccgtgggcacattcatactatattcg
ctttcatcttctcccatcctggtctggccagcgatagatggattcggcatatcggccatc
atcctgttccttgtattcaagatcgcattcgttgacaggagcagggcttctggcaggcct
gtgaatatctga

DBGET integrated database retrieval system