KEGG   Thermoplasma acidophilum: Ta1434Help
Entry
Ta1434            CDS       T00037                                 

Definition
(GenBank) conserved hypothetical protein
Organism
tac  Thermoplasma acidophilum
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Cob_adeno_trans
Motif
Other DBs
NCBI-ProteinID: CAC12554
UniProt: Q9HIA7
LinkDB All DBs
Structure
PDB: 

Position
1483526..1484059
Genome map
AA seq 177 aa AA seqDB search
MFTRRGDQGETDLANRARVGKDSPVVEVQGTIDELNSFIGYALVLSRWDDIRNDLFRIQN
DLFVLGEDVSTGGKGRTVTREMIDYLEARVKEMKAEIGKIELFVVPGGSIESASLHMARA
VSRRLERRIVAASKLTEINKNVLIYANRLSSILFMHALLSNKRLNIPEKIWSIHRVS
NT seq 534 nt NT seq  +upstreamnt  +downstreamnt
atgttcacaaggaggggcgatcagggcgaaacggaccttgcaaacagggccagggtaggc
aaggactctccagttgttgaggtccagggcacaatcgatgaactcaactcattcatagga
tacgcactggtgctgagcagatgggacgatatcaggaacgatcttttcaggatacagaac
gatctcttcgttttgggtgaggatgtatcaaccggcggaaagggtaggacagtaacgagg
gagatgatagactatctcgaagcccgcgtgaaggagatgaaggcagagatcggaaagata
gagcttttcgttgtgcctggcggttcgatagaatccgcctcgctccacatggcacgtgct
gtttcgaggaggcttgagaggaggatagttgcggcgtctaaactcacggagatcaacaag
aacgttctgatatatgccaacaggctctcatcgatactattcatgcacgcattgctttcc
aacaagaggctgaacataccagagaagatatggagcatacaccgcgtctcataa

DBGET integrated database retrieval system