KEGG   Thermodesulfobium acidiphilum: TDSAC_0401Help
Entry
TDSAC_0401        CDS       T05396                                 

Definition
(GenBank) ribulose 1,5-bisphosphate carboxylase large subunit
  KO
K01601  ribulose-bisphosphate carboxylase large chain [EC:4.1.1.39]
Organism
taci  Thermodesulfobium acidiphilum
Pathway
taci00630  Glyoxylate and dicarboxylate metabolism
taci01100  Metabolic pathways
taci01120  Microbial metabolism in diverse environments
taci01200  Carbon metabolism
Module
taci_M00166  Reductive pentose phosphate cycle, ribulose-5P => glyceraldehyde-3P
Brite
KEGG Orthology (KO) [BR:taci00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    TDSAC_0401
Enzymes [BR:taci01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.39  ribulose-bisphosphate carboxylase
     TDSAC_0401
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RuBisCO_large RuBisCO_large_N
Motif
Other DBs
NCBI-ProteinID: AWB09777
UniProt: A0A2R4VZ18
LinkDB All DBs
Position
397807..399096
Genome map
AA seq 429 aa AA seqDB search
MSNKLNIKYTNFLDFDYVPKKNDVLAAFYVEPAPGTDIKEAAGAVASESSIGTWTDLATM
KQSIWDELRARVYSIEGDVVRIAYPDVLFEAANLPQFLSSIAGNVFGMKAVENLRLLDIV
LTQKFLDELNGPAFGVEGVREVLNVKDRPLVGTIVKPKLGLDPKEQAKVVYESLVGGLDL
VKDDENLTHQDFSNFDERVKYSLDAVRRAEKETGEKKAYLPNVTAPTEEMLRRATLVKQE
GGKYAMVDVITTGFAGVQSLRNANTGLILHAHRAMYASFARSKKHGIHMLVLSKLLRFAG
VDQLHIGTVVGKMEGDRDDVLVCHEALGSSSEMKVKTYLPHQEWGNMKSVFSVASGGLHP
GHTADLYKIFGKNAIFQYGGGVHGHPEGTRMGARAVRDAVECAVKGITLKEGAKSSKALE
IALSKWGGA
NT seq 1290 nt NT seq  +upstreamnt  +downstreamnt
atgagcaataaattaaatattaaatatacaaattttttggattttgactacgttccgaaa
aaaaatgatgtgctggctgccttttacgtggaacctgctccagggacagacattaaagag
gctgctggagctgtggcatctgagtcatctataggtacatggacagatcttgctactatg
aaacaaagtatttgggatgaattgagagcaagagtttattctatagaaggcgatgttgta
aggatagcatatccagacgtgctctttgaagcagctaatcttcctcagtttttaagtagc
attgcgggaaacgtctttggaatgaaagcagtagaaaatttaaggttgttagacatcgtt
ctcacacaaaaatttttggatgagttaaatggacctgcttttggagtagagggcgtaaga
gaggtattgaacgtcaaggacagacccttggttggaactattgttaagccaaagttaggg
cttgatccaaaggagcaggcaaaggtagtatatgaatctcttgttggtggtttagatctg
gtaaaggatgatgaaaacctcactcatcaagatttttctaattttgatgagagggtaaaa
tattcgctcgatgcggttaggcgcgctgaaaaagagactggtgagaaaaaggcatatctg
ccaaacgttacagctcccacagaggagatgttaagaagagctactctggttaaacaagaa
ggtggaaagtatgcgatggtggacgtaataaccacaggtttcgcaggggttcaaagtctc
aggaatgcaaatacagggctgatactacatgctcacagggctatgtatgcaagctttgca
agaagcaaaaaacacggcattcacatgttagttctctcaaagcttttgagatttgcagga
gtggaccagcttcatattggcactgtagtaggaaaaatggaaggagatagggatgacgta
ttggtgtgtcatgaagctttgggttctagcagtgaaatgaaagtgaaaacatatttgcca
catcaagaatggggcaatatgaagagcgttttttctgtagcatctggtgggcttcaccca
ggccatacagctgatctttataaaatatttgggaaaaatgctatttttcaatatggcgga
ggagttcacggacatccagaaggaaccagaatgggtgcaagggctgtaagggatgcagtt
gagtgtgctgttaagggaataactttgaaagaaggggcaaagagcagcaaggcgcttgaa
attgccctatcaaaatggggaggtgcataa

DBGET integrated database retrieval system