KEGG   Trichoplax adhaerens: TRIADDRAFT_26932Help
Entry
TRIADDRAFT_26932  CDS       T01069                                 

Definition
(RefSeq) hypothetical protein
  KO
K01187  alpha-glucosidase [EC:3.2.1.20]
Organism
tad  Trichoplax adhaerens
Pathway
tad00052  Galactose metabolism
tad00500  Starch and sucrose metabolism
tad01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:tad00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    TRIADDRAFT_26932
   00500 Starch and sucrose metabolism
    TRIADDRAFT_26932
Enzymes [BR:tad01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.20  alpha-glucosidase
     TRIADDRAFT_26932
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_31 NtCtMGAM_N Trefoil Gal_mutarotas_2 DUF5110
Motif
Other DBs
NCBI-GeneID: 6754572
NCBI-ProteinID: XP_002113715
JGI: 26932
UniProt: B3RZE9
LinkDB All DBs
AA seq 990 aa AA seqDB search
MAEEENQQSNGRRRLGIIIAITTIILAAIIVPITVVAVNQRQILQSTPSSSVSPDPSGSV
NCGASVCPTNINHRIDCYPEPGVTQNLCTQRGCCWQPSSQIQGAPSCFFPVGNHGYSAVK
QVESTTSGYSATLSRCNTAQYLRQGLLRLAINVAIPSKNRLRIKIFDPAVQRFEVPLKLP
SMSGSRVDNADFNVAFNSTPFAISVTRKSTGAAIFDTSLGGFVFEDQFLQISSKLPSRYV
YGLGEHEHRSFKHENFNWKRWPMFSRDQPPGEDHNLYGVHPFYLVMEGDNTANSYGVLFL
NSNAMEATLSPNPAITFTTTGGILDFYIFTGDNPEAVVENYLSFIGKPFIPPYWALGFQL
SRYGYNSLSRVQQIMSDMKKYDIPMDILYGDIDYMRHRLDFTIDPINYNGLSEYVDELHS
QGLHYITILDPAISDNQTQGTYPAYDDGIAKGIFINDSRTPNAPLIGKVWPRGNATFPDY
FNPRAEKWWTDLIVNFHNELAFDGIWIDMNEPANFVLGSVNGCPNNTWNHAPYKPVSIRG
NVLYDKTICMDALQYISKHYDMHSLFGHSQLLPTIKATRAANPGKRSFVITRSTYPGDGQ
YGGHWLGDNYSGWPPLHFSIIGSLEFNIFGIPYIGADICGYFDDTQFELCLRWMQLGAFY
TFSRNHNGYGYIRQDPAGFDTTFALISRDVLTIRYRLLPYLYTLFYQSRNTGATVMRPLM
FEFPLDKTCRTADRQFLWGPAFLISPVLLQGVIDWTFYLPSGRWYDYYTVLTPTMRNVTV
PVTLYSVPLHIRGGFILPVQKPANTTVYSRMNPFGLIAALNTTNEAKGSLFWDDGDSLNT
FENGDYVLIEFTATSNSLESTVKTNAYAIESNLDYITVLGLPNAPSAVSVNGVSTVNFSF
NPTHKVNQVPNFYSFKIKFLSQLFRIRLGFRDNDQNIRQLLLSNVNKKFILEIRKYSNDT
SSIIIIPSFQVLNVTSLDRDLNQPFRINWN
NT seq 2973 nt NT seq  +upstreamnt  +downstreamnt
atggcagaagaagagaatcaacagtctaatgggcgtcggcgtcttggtattatcatcgcg
attacgactattattcttgcagcgatcatcgttccaatcactgtcgttgcggtcaaccag
aggcaaattcttcaatcgactccaagcagcagcgtctctcctgatccttcgggctctgtt
aattgtggcgcatcggtctgcccaaccaacattaatcacaggattgattgctatccagaa
cctggtgttactcaaaatttatgcactcaacgtggatgttgttggcagccatccagccaa
attcaaggggcgccatcctgtttctttccagtaggaaatcatggctattctgcagtcaaa
caagtggaatcgacgacatccggctattcagcaacactatcacgttgtaacactgcacaa
tatctacgccaaggattgcttcgccttgcaatcaatgtggcaatcccttccaaaaatagg
ctaagaattaagatatttgacccagctgttcaacgttttgaggttccattgaaactacct
tccatgagcggtagtagagtagacaatgctgacttcaatgttgcatttaattcaactcct
ttcgctatatcagtaacaagaaagtccactggtgccgccatttttgatacttctcttggt
ggctttgtctttgaagatcaattcttgcaaatatcgtcaaaattaccctcccgttacgtg
tatggtctaggtgaacatgaacatcgtagttttaaacatgaaaattttaattggaaaaga
tggccgatgttctctagagatcaacctccaggagaagatcacaatttatacggtgttcat
cccttctatcttgtcatggaaggcgataatacggccaacagctatggagttcttttctta
aatagtaacgctatggaagctacactttctcccaatccggccataacgttcacaacaact
ggaggaattttagacttctatatctttaccggtgataatcccgaagctgttgttgaaaac
tacttgagtttcattggtaagccttttattcctccatattgggcgcttggattccaactt
agtcgatatggctacaactctttatcacgcgttcagcaaattatgtctgacatgaaaaaa
tacgacattcctatggatatcctatacggcgatatcgattatatgcgacataggctcgat
tttactattgatcctatcaattataatggactatcagaatatgttgatgaattacatagc
cagggattacactatatcacgattctggatccagctatcagtgataatcaaacacaggga
acttatccggcgtatgatgatggtattgcaaagggtatttttattaatgattcaagaact
ccaaatgcaccactaattggcaaggtttggcctagaggaaatgcaacattccctgactat
ttcaatcctcgtgcagaaaaatggtggactgatttgatagtcaactttcataatgaactt
gcattcgatgggatttggatagatatgaatgaaccagccaactttgtgcttggatctgtt
aatggctgtccaaacaatacttggaatcatgcaccatataaaccagtttccattagagga
aatgttttatatgataaaacaatctgtatggacgctttgcagtatatttccaagcattac
gatatgcatagtctctttggacatagccagttactaccaacgattaaagcaactagagca
gcgaatcctggtaaacgaagttttgtaattactcgttctacataccctggagatggtcag
tatggtggtcattggttaggagataattattctggctggccgcctcttcatttctctata
atcggctccttggaatttaacatctttggcataccatacattggtgctgatatctgcgga
tattttgacgatacccagtttgaattatgcttacgttggatgcaactaggtgcattctat
accttttctagaaatcataatggctatggttatataagacaagaccctgcaggtttcgat
acaacttttgcgctaatatcccgtgatgtcctgacgatccgttatagacttttaccatat
ttatatacccttttctatcaatcaagaaatactggtgcaacagttatgagaccactaatg
tttgaatttcctttggataaaacatgtcgtaccgcagatcgtcaatttctttggggccca
gcgtttttgatatctccggtattgcttcaaggagttatagactggaccttctatttacct
agtggacggtggtatgattactacactgtattaacacccacgatgcgaaacgttactgtt
ccagttacattgtatagcgtacctttacatattcggggtggatttatactgcctgtgcaa
aagccggcaaacactaccgtttatagtcgaatgaatccatttggtctaatcgcggccctg
aatactactaatgaagcgaaaggcagtctgttttgggatgatggcgattcattgaataca
ttcgaaaatggtgattatgtgctgattgaatttacagcaacatctaattcactagaatca
actgtaaaaaccaatgcgtatgcaatagaaagcaatctggattatattactgttcttggt
ctaccaaatgctccgtcagctgtttccgtgaatggtgtctcgacagtcaatttcagtttt
aatcctacccataaggtaaaccaggtccctaatttttacagctttaagattaaatttttg
tctcaactattccgaattcgactaggatttcgtgataatgatcaaaatattcgacaacta
cttttatcaaacgttaataaaaaatttattttagaaatacggaaatatagcaatgataca
tccagtataattattattccttcatttcaggtgctgaatgttactagtttagacagggac
ttgaatcaacctttccgaataaattggaactga

DBGET integrated database retrieval system