KEGG   Trichoplax adhaerens: TRIADDRAFT_34128Help
Entry
TRIADDRAFT_34128  CDS       T01069                                 

Definition
(RefSeq) hypothetical protein
  KO
K02350  DNA polymerase zeta [EC:2.7.7.7]
Organism
tad  Trichoplax adhaerens
Pathway
tad03460  Fanconi anemia pathway
Brite
KEGG Orthology (KO) [BR:tad00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03460 Fanconi anemia pathway
    TRIADDRAFT_34128
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:tad03400]
    TRIADDRAFT_34128
Enzymes [BR:tad01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.7  DNA-directed DNA polymerase
     TRIADDRAFT_34128
DNA repair and recombination proteins [BR:tad03400]
 Eukaryotic type
  TLS (translesion DNA synthesis) factors
   B-family DNA polymerases
    TRIADDRAFT_34128
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DNA_pol_B zf-C4pol DNA_pol_B_exo1 DNA_pol_B_2
Motif
Other DBs
NCBI-GeneID: 6759600
NCBI-ProteinID: XP_002118387
JGI: 34128
UniProt: B3SDS4
LinkDB All DBs
AA seq 765 aa AA seqDB search
MFYPARLNAIYTVLFRWDPDILVGYEIQMLSWGYLLQRSKSLQIDLATLLSRVPSVNNKF
QLELENDFQANYKTDVFIVGRVIVNIWRIMRYEVVALRSYTFESVIDHVLHRRHALHTFR
SLTDWFHDDRNRWRTIEYYIIRCRGNWRLLETFDMIDRSSEFARLYGIQFYSVLSRGSQF
RIESMLLRLAKPMNYIPVSVSEKQRTWMKAPEVIPLVMEPESRFYSNPVLVLDFQSLYPS
VMIAYNYCYTTCLGRISGIATDKEFKFGCTSHQVPLSLLKKLRNDISIAPCGAVYVKDHI
RKGVIPRMLKEILDTRIMIKRAMKDCKDNKSLHRLLDIRQFGLKMIANVTYGYAGATFSG
RMPLIELADSIVSKARETLERAIKIVNTTSKWNARVVYGDTDSMFVLLEGATKARAFEIG
REIAETITSMNPKPVALKFEKVFLPSLLITKKRYVGYAYESADQKEPTFDAKGIETVRRD
GCPAVSKIMEKAIRILFSRRDMSLVKKYVLHKCRMLIEGKVAINDYVIAKEYRGKSTYKP
GACVPALEITKQLLAHDRRSEPRIGERVPYVIVYGVPGVPLIRLVRRPRELLNDPNLRLN
ATYYITKQILPALDRLLSLIGIDVESWHAELPRSIRSDVINQSQFQVAKQGVISQYFSSL
HCLVCEEMTVDGVCPSCIRDSQKAIMIAQQRISDFERKNRHLKEICCNCIGQRVINAECI
SLDCPILFETKRNQRDVDCIPRLREFISKISTIACSSIAEAQITG
NT seq 2298 nt NT seq  +upstreamnt  +downstreamnt
atgttttatccagcaaggctaaatgcgatctacactgttcttttcagatgggatccagac
atcttagtcgggtacgaaattcaaatgttgtcttgggggtatttgttgcagcggagtaaa
agtcttcaaatcgatttagcgactttattatctagagttccatctgtaaataataaattt
caactggagttggaaaatgatttccaggctaactataagactgatgtattcattgttggt
agagtaatagtcaatatttggcgtattatgcgttatgaggtagtcgcgttaagaagctat
acttttgaaagtgtaatagaccatgttttacatcgccgacatgcattacatacttttcgc
tctttgacggattggtttcatgatgatagaaatcggtggcgcaccatagaatattacatt
attcgatgtcgtggtaattggcgactactcgaaaccttcgatatgattgatagaagcagt
gaattcgctcggctctatggtattcaattttactctgtcctttcaagagggagtcagttt
cgtattgagtcgatgcttcttcgactggcgaaaccgatgaattatattccggtgtcggtt
agcgagaagcagcgaacttggatgaaggcccctgaagtgattccattagttatggaacca
gaatcacgattttattcgaatcctgtgttggttctagattttcaatctttatatccatct
gtgatgatagcatacaattactgttataccacttgtcttggccgcatttctggaattgca
acggataaagaatttaaatttggctgcacatcacaccaagttccgttgtctttgctaaag
aagctacgaaatgatataagcattgcaccatgtggagcagtctatgtaaaagaccatatt
cgaaaaggcgtaataccgagaatgttgaaagaaatattagacacacgtatcatgataaag
cgagctatgaaggattgcaaagataataagtcacttcatcgcctcctcgatatacgacag
tttggtttaaaaatgatagctaacgtaacatatgggtatgcaggggcaacgttcagtggt
cgaatgccgttaatcgagttagctgacagtatcgtcagcaaagcacgcgaaactctagaa
cgtgctattaagattgtcaatacgaccagtaagtggaatgccagagttgtatatggtgat
acagacagtatgttcgtactgctggagggtgcaaccaaagctagagcttttgaaattggt
cgagaaattgctgagactatcacatctatgaatcccaagccagtagctttaaagttcgaa
aaggtatttttaccctcactattaataacgaaaaagcggtatgtcggctacgcatatgaa
tctgccgaccagaaagagcctacttttgatgctaaaggtatcgaaactgttcgaagagat
ggttgtcctgcagtgtcaaagatcatggaaaaagcaattaggatactattctctagacgt
gatatgtcacttgtcaagaaatatgtattgcataagtgtcgaatgcttatagaaggcaag
gtcgcaattaatgactatgttatcgctaaagaatatcgtggcaagagcacctacaagccg
ggtgcttgtgtgccggctttagaaatcaccaagcagttgctggctcatgatagacgatca
gagcctcgtattggagagcgcgtgccatacgtcatcgtctacggtgtacctggagtgcca
ttaattcgtctcgttagaagaccacgtgaacttttaaatgacccaaatttacgccttaat
gccacttattacatcaccaaacaaatactgccagctttagacagattactgtctctaatt
ggcattgatgttgaaagctggcatgctgaactacccagatccattcgatcagacgtaatt
aaccagagtcagtttcaggtggcaaagcaaggggtaatttcacaatattttagcagcttg
cactgcctagtttgcgaggaaatgactgttgatggtgtttgcccttcgtgtatccgagat
tctcaaaaagcaatcatgattgcccagcaacggatatcagattttgagagaaaaaatcgt
catcttaaagagatatgctgcaattgtattggtcaacgtgtgattaatgctgaatgtatc
tctctggactgtccaattctgtttgaaactaagcgaaaccaacgagatgttgattgcatt
ccgcgtttgcgtgaatttatatcgaaaatatccacgattgcttgtagttctatcgctgaa
gcacaaattacagggtaa

DBGET integrated database retrieval system