KEGG   Trichoplax adhaerens: TRIADDRAFT_3759Help
Entry
TRIADDRAFT_3759   CDS       T01069                                 

Definition
(RefSeq) hypothetical protein
Organism
tad  Trichoplax adhaerens
SSDB OrthologParalogGFIT
Motif
Pfam: 7tm_1 7tm_4 7TM_GPCR_Srsx 7TM_GPCR_Srx 7TM_GPCR_Srv
Motif
Other DBs
NCBI-GeneID: 6754575
NCBI-ProteinID: XP_002113363
JGI: 3759
UniProt: B3RZG1
LinkDB All DBs
AA seq 284 aa AA seqDB search
VYLILQATILSIITLFMIVGNFIVIVVVNRSEQLQNATGIFMANLAVTDLTLGVILMPIT
IASSILGRWIFSDIMCKFCGFLNVMLCSTSALTVMLLSIDRFIAISRPMQYIKIMSKKRA
LVLSTYMWIHSAIVSTFPLLGWAKYEYVEAEAVCFAIESVSYFNFLCASTVFLAIFLIII
THIYILKVAIKQSQQIVTLTPGFEDVTRETMRQMNRKTAKTVLIIVGVYLACWIPYISLT
YVQIYANYVPPPIAITITSGLIFVNSASNPIIYGTFHRRFRNAF
NT seq 852 nt NT seq  +upstreamnt  +downstreamnt
gtttatcttattttacaagccactatattatccattattaccctatttatgattgtaggc
aattttatcgttattgtagttgttaatcgttcagaacagctacaaaatgctaccggtatc
tttatggccaacttagccgttaccgatttaactttaggtgttattttaatgcccattacc
attgctagctccatcttaggccgttggatatttagtgatataatgtgtaaattttgcggt
tttttaaatgttatgttatgcagcacatcagcattaactgtcatgttattgagtatcgac
cgttttattgctatttcacgtccaatgcaatatattaaaattatgtccaaaaagcgagcc
ttagtgttatccacttacatgtggatccattcagctatcgtctcgacatttccattacta
ggttgggctaaatatgaatatgttgaagccgaagcagtttgttttgctatcgaaagtgta
tcctattttaattttctatgcgcatcgacagtatttttggctatctttttaattatcatt
acccatatctacatcttaaaagtggctatcaagcaatcacagcaaattgtaaccttaaca
cctggttttgaagatgtcacaagagaaacgatgcgccaaatgaatcgtaaaacagccaag
actgtcttaattattgttggtgtctatttagcctgttggataccttatatttcattaact
tatgtccaaatttacgctaactatgttccaccaccaattgctattacaatcacatcaggt
ctaatttttgtcaattcagcatccaatccaattatttatggtacattccatcgacgtttt
cgtaatgctttc

DBGET integrated database retrieval system