KEGG   Trichoplax adhaerens: TRIADDRAFT_37971Help
Entry
TRIADDRAFT_37971  CDS       T01069                                 

Definition
(RefSeq) expressed hypothetical protein
Organism
tad  Trichoplax adhaerens
SSDB OrthologParalogGFIT
Motif
Pfam: Trypsin Trypsin_2
Motif
Other DBs
NCBI-GeneID: 6755373
NCBI-ProteinID: XP_002114160
JGI: 37971
UniProt: B3S1L4
LinkDB All DBs
AA seq 276 aa AA seqDB search
MKILVIVALFACATAFRLPPAFKQVPRPADWRPQPKWEVDDDKIVGGVEATQNEFPFIVS
LRRKPWWLGSTASHFCGGSIIGANKVLTAAHCTSGTSASDINVAAGQFDKSSDSDDNEQI
RTALRKSEHSDYNSQTIDMDFAVLTMSSSFTLNTNVAKITMGGAQPGQMLTVSGWGTLSA
GGSSPNNLQRVDVPAITNTECNAAYKGGITDNMLCAGYSAGGKDSCQGDSGGPLVRFDGT
TPTLVGVVSWGNGCAEPGYPGVYARCSKEQSWIMSQ
NT seq 831 nt NT seq  +upstreamnt  +downstreamnt
atgaagattttggttattgtcgctcttttcgcttgcgctaccgccttcaggcttccacct
gcttttaagcaagtaccacgcccagctgattggcgcccacaaccaaaatgggaagttgac
gatgacaagatcgtcggtggagtagaagctacacaaaatgagttcccattcatcgtttcc
ttgagaaggaagccttggtggctcggcagcactgcttctcacttctgtggtggttccatc
attggagctaacaaagttctcactgctgctcactgtacttccggtacctctgcttctgat
attaacgttgctgctggtcaatttgacaaaagcagtgattctgacgacaatgaacaaatt
cgaactgctttgaggaaatctgagcattccgactataactctcaaacaattgatatggat
ttcgcagtcttgacaatgtctagctcgtttacattaaacacaaatgttgctaaaattaca
atgggaggagctcaacctggtcaaatgcttactgtttctggttggggtactctttccgca
ggtggttcctcccctaacaatcttcaaagagtagatgtccctgctatcacaaatactgaa
tgtaatgctgcctataagggcggaatcaccgataacatgctatgcgctggttacagtgct
ggtggcaaagattcttgtcaaggtgacagtggtggcccattggtccgttttgatggtaca
actccaacccttgtcggtgttgttagctggggcaatggctgtgctgaaccaggatatcca
ggcgtttatgcccgttgctcgaaagaacaaagctggatcatgtcacagtaa

DBGET integrated database retrieval system