KEGG   Trichoplax adhaerens: TRIADDRAFT_38520Help
Entry
TRIADDRAFT_38520  CDS       T01069                                 

Definition
(RefSeq) hypothetical protein
  KO
K00234  succinate dehydrogenase (ubiquinone) flavoprotein subunit [EC:1.3.5.1]
Organism
tad  Trichoplax adhaerens
Pathway
tad00020  Citrate cycle (TCA cycle)
tad00190  Oxidative phosphorylation
tad01100  Metabolic pathways
tad01200  Carbon metabolism
Module
tad_M00009  Citrate cycle (TCA cycle, Krebs cycle)
tad_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
tad_M00148  Succinate dehydrogenase (ubiquinone)
Brite
KEGG Orthology (KO) [BR:tad00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    TRIADDRAFT_38520
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    TRIADDRAFT_38520
Enzymes [BR:tad01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     TRIADDRAFT_38520
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: FAD_binding_2 Succ_DH_flav_C
Motif
Other DBs
NCBI-GeneID: 6759351
NCBI-ProteinID: XP_002118157
JGI: 38520
UniProt: B3SD21
LinkDB All DBs
AA seq 588 aa AA seqDB search
MGLSMAGFKTACISKLFPTRSHTVAAQGGINAALGNMEEDDWKWHMFDTVKGSDWLGDQN
SIHYMTREAPKAVIELENFGMPFSRTESGKIYQRAFGGQSLKYGKGGQAHRCCCVADRTG
HSLLHTLYGRSLKYDTHFFIEYFALDLIMKDGACIGVIAMDMEDGSIHRFRAKNTVLATG
GYGRAYFSCTSAHTCTGDGTAMVSRAGLANEDMEFVQFHPTGIYGAGCLITEGCRGEGGY
LINSEGERFMERYAPTAKDLASRDVVSRSMTMEIREGRGCGPDKDHVYLQLSHLPPETLR
TRLPGISETAMIFAGVDVTKEPIPVIPTVHYNMGGVPTLYNGQAIQYTKEGGDVIVPGLY
AAGEAACASVHGANRLGANSLLDLVIFGRACALHIEETCKPGDSIADLPSNAGEETVANV
DKLLHANGAIPTADLRLKLQKTMQNNAAVFRTGPVLEEGCKLIDEIYNQMGDIRLSDRGL
VWNSDLIETLELQNILVNSVQTIYAAQAREESRGAHAREDFKDRVDEYDYSKPLEGQQEK
PFNQHWRKHTMSYVDHRTGKSHLEYRPVIDDTMDEKECAPVPPAVRSY
NT seq 1767 nt NT seq  +upstreamnt  +downstreamnt
atgggtttatccatggcaggctttaaaactgcctgcatttctaaattattcccaacaaga
tctcatactgtagctgctcagggtggcattaatgcagcattgggcaatatggaagaagat
gattggaaatggcatatgtttgatactgtaaagggtagtgattggctaggtgatcaaaat
tcaattcattacatgactagagaagctcctaaggccgttatcgagctggaaaatttcggg
atgcctttcagtcgcaccgagagcgggaaaatttatcagcgtgcttttggtgggcaaagc
ttgaagtatggtaaaggtggccaggctcatcgatgttgttgcgttgccgatcgtactggt
cattccttattacatacgctttatggcaggtcactgaagtacgacacccacttctttatt
gaatattttgcactggatctcattatgaaagacggagcttgcatcggggttatagctatg
gacatggaagatggtagcattcaccgctttcgagccaagaatacagttcttgcaactggt
ggatatggacgtgcctacttttcctgcacttcagctcatacttgcacaggcgatggaaca
gctatggtgtccagagcaggattagcaaatgaagatatggaatttgttcaatttcatcca
acaggtatttatggcgcaggatgtttaattacagaaggttgtcgtggcgaaggaggatat
ctgattaattctgagggtgagcgctttatggagcgctatgcaccaactgctaaagatcta
gcatctagagatgtagtttctaggtctatgactatggaaattagagaaggaagggggtgc
ggcccagataaagatcacgtatacttacaactatcccatctaccgcctgagacccttaga
acccgtctgcctggtatatctgaaacagctatgatctttgctggtgttgatgtaacaaaa
gaaccaatacctgtcattccaactgttcattacaacatgggaggagtccctactctctac
aatggacaggccattcagtatacaaaagaaggtggtgacgttatcgtgcctggtctgtat
gctgctggtgaagccgcttgtgcctctgttcacggcgctaatcgcttgggcgctaatagc
ttactggatttagtaatatttggaagagcttgtgcattgcatattgaagaaacttgcaaa
cctggcgactctatagcagatttaccatcgaatgcaggagaggaaaccgtagccaatgtt
gacaaactacttcatgctaatggtgccatacctacggctgatttaagactaaaattgcaa
aaaactatgcaaaacaatgcagcagtattcaggactggaccagtattggaagaaggttgc
aagttaattgatgaaatttataatcaaatgggcgacattcgtttatccgaccgtggactt
gtatggaattcagatttaatcgaaaccttggaacttcaaaatattcttgttaactccgtt
caaactatctatgctgcacaagcacgtgaagaaagtcgaggagctcacgctcgtgaagat
ttcaaagacagagtagatgaatacgattattctaaaccgctggaaggccaacaagagaaa
ccgttcaatcaacactggcggaagcatactatgtcatatgtcgatcatcgaactggcaaa
tctcacttagagtatcgtccagtaattgatgatacaatggatgaaaaagaatgcgctccg
gttccccctgcagttcgatcatactaa

DBGET integrated database retrieval system